Q86UX2 · ITIH5_HUMAN
- ProteinInter-alpha-trypsin inhibitor heavy chain H5
- GeneITIH5
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids942 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May act as a tumor suppressor.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | collagen-containing extracellular matrix | |
Cellular Component | extracellular region | |
Molecular Function | serine-type endopeptidase inhibitor activity | |
Biological Process | hyaluronan metabolic process |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameInter-alpha-trypsin inhibitor heavy chain H5
- Short namesITI heavy chain H5; ITI-HC5; Inter-alpha-inhibitor heavy chain 5
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ86UX2
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_042847 | 139 | in dbSNP:rs12761771 | |||
Sequence: E → K | ||||||
Natural variant | VAR_042848 | 207 | in dbSNP:rs36056263 | |||
Sequence: N → H | ||||||
Natural variant | VAR_055973 | 421 | in dbSNP:rs36056263 | |||
Sequence: N → H | ||||||
Natural variant | VAR_061276 | 496 | in dbSNP:rs35892621 | |||
Sequence: V → M | ||||||
Natural variant | VAR_042849 | 570 | in dbSNP:rs2275069 | |||
Sequence: T → P | ||||||
Natural variant | VAR_042850 | 629 | in dbSNP:rs34213756 | |||
Sequence: R → C | ||||||
Natural variant | VAR_055974 | 925 | in dbSNP:rs10795551 | |||
Sequence: F → S |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 7 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-16 | |||||
Sequence: MLLLLGLCLGLSLCVG | ||||||
Chain | PRO_0000331408 | 17-942 | Inter-alpha-trypsin inhibitor heavy chain H5 | |||
Sequence: SQEEAQSWGHSSEQDGLRVPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEELLQRRLGKYEHSISVRPQQLSGRLSVDVNILESAGIASLEVLPLHNSRQRGSGRGEDDSGPPPSTVINQNETFANIIFKPTVVQQARIAQNGILGDFIIRYDVNREQSIGDIQVLNGYFVHYFAPKDLPPLPKNVVFVLDSSASMVGTKLRQTKDALFTILHDLRPQDRFSIIGFSNRIKVWKDHLISVTPDSIRDGKVYIHHMSPTGGTDINGALQRAIRLLNKYVAHSGIGDRSVSLIVFLTDGKPTVGETHTLKILNNTREAARGQVCIFTIGIGNDVDFRLLEKLSLENCGLTRRVHEEEDAGSQLIGFYDEIRTPLLSDIRIDYPPSSVVQATKTLFPNYFNGSEIIIAGKLVDRKLDHLHVEVTASNSKKFIILKTDVPVRPQKAGKDVTGSPRPGGDGEGDTNHIERLWSYLTTKELLSSWLQSDDEPEKERLRQRAQALAVSYRFLTPFTSMKLRGPVPRMDGLEEAHGMSAAMGPEPVVQSVRGAGTQPGPLLKKPYQPRIKISKTSVDGDPHFVVDFPLSRLTVCFNIDGQPGDILRLVSDHRDSGVTVNGELIGAPAPPNGHKKQRTYLRTITILINKPERSYLEITPSRVILDGGDRLVLPCNQSVVVGSWGLEVSVSANANVTVTIQGSIAFVILIHLYKKPAPFQRHHLGFYIANSEGLSSNCHGLLGQFLNQDARLTEDPAGPSQNLTHPLLLQVGEGPEAVLTVKGHQVPVVWKQRKIYNGEEQIDCWFARNNAAKLIDGEYKDYLAFHPFDTGMTLGQGMSREL | ||||||
Glycosylation | 97 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 127 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 231 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 421 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 508 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 776 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 795 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 862 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Abundantly expressed in placenta. Less abundant expression in mammary gland and ovary. Expression is barely detectable levels in all other tissues tested.
Induction
Down-regulated in breast tumors.
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 35-161 | VIT | ||||
Sequence: VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE | ||||||
Region | 116-136 | Disordered | ||||
Sequence: KKSGDRVKEKRNKTTEENGEK | ||||||
Region | 208-227 | Disordered | ||||
Sequence: SRQRGSGRGEDDSGPPPSTV | ||||||
Domain | 295-478 | VWFA | ||||
Sequence: NVVFVLDSSASMVGTKLRQTKDALFTILHDLRPQDRFSIIGFSNRIKVWKDHLISVTPDSIRDGKVYIHHMSPTGGTDINGALQRAIRLLNKYVAHSGIGDRSVSLIVFLTDGKPTVGETHTLKILNNTREAARGQVCIFTIGIGNDVDFRLLEKLSLENCGLTRRVHEEEDAGSQLIGFYDEI | ||||||
Region | 550-571 | Disordered | ||||
Sequence: QKAGKDVTGSPRPGGDGEGDTN |
Sequence similarities
Belongs to the ITIH family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 4 isoforms produced by Alternative splicing.
Q86UX2-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length942
- Mass (Da)104,576
- Last updated2008-04-29 v2
- Checksum1666BE1C9B90ED61
Q86UX2-2
- Name2
Q86UX2-3
- Name3
Q86UX2-4
- Name4
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
C9J2H1 | C9J2H1_HUMAN | ITIH5 | 942 | ||
A0A096LP62 | A0A096LP62_HUMAN | ITIH5 | 728 | ||
H7C5A6 | H7C5A6_HUMAN | ITIH5 | 119 | ||
G5E9D8 | G5E9D8_HUMAN | ITIH5 | 702 |
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_033188 | 1-214 | in isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_035727 | 1-449 | in isoform 4 | |||
Sequence: Missing | ||||||
Sequence conflict | 188 | in Ref. 3; BAB55070 | ||||
Sequence: D → G | ||||||
Alternative sequence | VSP_033189 | 215-218 | in isoform 3 | |||
Sequence: RGED → MRNY | ||||||
Sequence conflict | 337 | in Ref. 3; BAB55070 | ||||
Sequence: S → P | ||||||
Sequence conflict | 343 | in Ref. 8; CAH10363 | ||||
Sequence: W → R | ||||||
Alternative sequence | VSP_035728 | 450-473 | in isoform 4 | |||
Sequence: LSLENCGLTRRVHEEEDAGSQLIG → MRTYDTPGTSMCIIPDDPHRNPRR | ||||||
Alternative sequence | VSP_033190 | 667-694 | in isoform 2 | |||
Sequence: YQPRIKISKTSVDGDPHFVVDFPLSRLT → NSVKKKQNKTKKRHGRDGVFPLHHLGIR | ||||||
Alternative sequence | VSP_035729 | 678-693 | in isoform 4 | |||
Sequence: VDGDPHFVVDFPLSRL → GKAKDAVVCGLRVRDV | ||||||
Alternative sequence | VSP_035730 | 694-942 | in isoform 4 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_033191 | 695-942 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 936 | in Ref. 1; AAO49812 | ||||
Sequence: Q → R |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY238437 EMBL· GenBank· DDBJ | AAO49812.1 EMBL· GenBank· DDBJ | mRNA | ||
AY358426 EMBL· GenBank· DDBJ | AAQ88792.1 EMBL· GenBank· DDBJ | mRNA | ||
AK027375 EMBL· GenBank· DDBJ | BAB55070.1 EMBL· GenBank· DDBJ | mRNA | ||
AF318347 EMBL· GenBank· DDBJ | AAL55854.1 EMBL· GenBank· DDBJ | mRNA | ||
AL158044 EMBL· GenBank· DDBJ | CAI12953.1 EMBL· GenBank· DDBJ | Genomic DNA | Frameshift | |
AL355374 EMBL· GenBank· DDBJ | CAI12953.1 EMBL· GenBank· DDBJ | Genomic DNA | Frameshift | |
AL158044 EMBL· GenBank· DDBJ | CAI12955.1 EMBL· GenBank· DDBJ | Genomic DNA | Frameshift | |
AL355374 EMBL· GenBank· DDBJ | CAI12955.1 EMBL· GenBank· DDBJ | Genomic DNA | Frameshift | |
AL355374 EMBL· GenBank· DDBJ | CAI16360.1 EMBL· GenBank· DDBJ | Genomic DNA | Frameshift | |
AL158044 EMBL· GenBank· DDBJ | CAI16360.1 EMBL· GenBank· DDBJ | Genomic DNA | Frameshift | |
AL355374 EMBL· GenBank· DDBJ | CAI16362.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL355374 EMBL· GenBank· DDBJ | CAI16363.1 EMBL· GenBank· DDBJ | Genomic DNA | Frameshift | |
AL158044 EMBL· GenBank· DDBJ | CAI16363.1 EMBL· GenBank· DDBJ | Genomic DNA | Frameshift | |
CH471072 EMBL· GenBank· DDBJ | EAW86379.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB075833 EMBL· GenBank· DDBJ | BAB85539.1 EMBL· GenBank· DDBJ | mRNA | ||
CR627109 EMBL· GenBank· DDBJ | CAH10363.1 EMBL· GenBank· DDBJ | mRNA |