Q86UU1 · PHLB1_HUMAN
- ProteinPleckstrin homology-like domain family B member 1
- GenePHLDB1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1377 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | basal cortex | |
Cellular Component | cytosol | |
Cellular Component | intercellular bridge | |
Cellular Component | intracellular membrane-bounded organelle | |
Cellular Component | plasma membrane | |
Biological Process | positive regulation of basement membrane assembly involved in embryonic body morphogenesis | |
Biological Process | regulation of epithelial to mesenchymal transition | |
Biological Process | regulation of gastrulation | |
Biological Process | regulation of microtubule cytoskeleton organization |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePleckstrin homology-like domain family B member 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ86UU1
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Involvement in disease
Osteogenesis imperfecta 23 (OI23)
- Note
- DescriptionAn autosomal recessive form of osteogenesis imperfecta, a disorder of bone formation characterized by low bone mass, bone fragility and susceptibility to fractures after minimal trauma. Disease severity ranges from very mild forms without fractures to intrauterine fractures and perinatal lethality. Extraskeletal manifestations, which affect a variable number of patients, are dentinogenesis imperfecta, hearing loss, and blue sclerae. OI23 is a mild form characterized by osteopenia with or without recurrent fractures, platyspondyly, short and bowed long bones, and widened metaphyses. Platyspondyly and metaphyseal enlargement is present in infancy but resolve in middle childhood.
- See alsoMIM:620639
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1,617 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000053891 | 1-1377 | UniProt | Pleckstrin homology-like domain family B member 1 | |||
Sequence: MDALNRNQIGPGCQTQTMVQKGPLDLIETGKGLKVQTDKPHLVSLGSGRLSTAITLLPLEEGRTVIGSAARDISLQGPGLAPEHCYIENLRGTLTLYPCGNACTIDGLPVRQPTRLTQGCMLCLGQSTFLRFNHPAEAKWMKSMIPAGGRAPGPPYSPVPAESESLVNGNHTPQTATRGPSACASHSSLVSSIEKDLQEIMDSLVLEEPGAAGKKPAATSPLSPMANGGRYLLSPPTSPGAMSVGSSYENTSPAFSPLSSPASSGSCASHSPSGQEPGPSVPPLVPARSSSYHLALQPPQSRPSGARSESPRLSRKGGHERPPSPGLRGLLTDSPAATVLAEARRATESPRLGGQLPVVAISLSEYPASGALSQPTSIPGSPKFQPPVPAPRNKIGTLQDRPPSPFREPPGSERVLTTSPSRQLVGRTFSDGLATRTLQPPESPRLGRRGLDSMRELPPLSPSLSRRALSPLPTRTTPDPKLNREVAESPRPRRWAAHGASPEDFSLTLGARGRRTRSPSPTLGESLAPHKGSFSGRLSPAYSLGSLTGASPCQSPCVQRKLSSGDLRVPVTRERKNSITEISDNEDDLLEYHRRQRQERLREQEMERLERQRLETILNLCAEYSRADGGPEAGELPSIGEATAALALAGRRPSRGLAGASGRSSEEPGVATQRLWESMERSDEENLKEECSSTESTQQEHEDAPSTKLQGEVLALEEERAQVLGHVEQLKVRVKELEQQLQESAREAEMERALLQGEREAERALLQKEQKAVDQLQEKLVALETGIQKERDKEAEALETETKLFEDLEFQQLERESRVEEERELAGQGLLRSKAELLRSIAKRKERLAILDSQAGQIRAQAVQESERLARDKNASLQLLQKEKEKLTVLERRYHSLTGGRPFPKTTSTLKEMEKLLLPAVDLEQWYQELMAGLGTGPAAASPHSSPPPLPAKASRQLQVYRSKMDGEATSPLPRTRSGPLPSSSGSSSSSSQLSVATLGRSPSPKSALLTQNGTGSLPRNLAATLQDIETKRQLALQQKGQQVIEEQRRRLAELKQKAAAEAQCQWDALHGAAPFPAGPSGFPPLMHHSILHHLPAGRERGEEGEHAYDTLSLESSDSMETSISTGGNSACSPDNMSSASGLDMGKIEEMEKMLKEAHAEKNRLMESREREMELRRQALEEERRRREQVERRLQSESARRQQLVEKEVKMREKQFSQARPLTRYLPIRKEDFDLKTHIESSGHGVDTCLHVVLSSKVCRGYLVKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVIYFQAIEEVYYDHLRSAAKKRFFRFTMVTESPNPALTFCVKTHDRLYYMVAPSAEAMRIWMDVIVTGAEGYTQFMN | |||||||
Modified residue (large scale data) | 47 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 51 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 51 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 52 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 131 | UniProt | Asymmetric dimethylarginine | ||||
Sequence: R | |||||||
Modified residue (large scale data) | 157 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 172 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 188 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 191 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 192 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 192 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 220 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 220 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 223 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 223 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 291 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 324 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 324 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 332 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 334 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 334 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 381 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 381 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 404 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 404 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 419 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 428 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 430 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 430 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 443 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 443 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 461 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 461 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 463 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 465 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 470 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 470 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 477 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 489 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 489 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 501 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 501 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 512 | UniProt | Omega-N-methylarginine | ||||
Sequence: R | |||||||
Modified residue (large scale data) | 516 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 518 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 518 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 520 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 520 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 522 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 522 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 533 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 533 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 539 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 539 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 543 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 548 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 551 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 551 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 555 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 555 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 563 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 563 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 564 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 578 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 578 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 580 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 583 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 583 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 624 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 638 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 654 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 664 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 665 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 678 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 678 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 682 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 692 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 693 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 942 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 970 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 971 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 971 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1002 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1004 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1015 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 1017 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1017 | PRIDE | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q86UU1 | FXR1 P51114 | 2 | EBI-4289858, EBI-713291 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 64-125 | FHA | ||||
Sequence: TVIGSAARDISLQGPGLAPEHCYIENLRGTLTLYPCGNACTIDGLPVRQPTRLTQGCMLCLG | ||||||
Region | 150-187 | Disordered | ||||
Sequence: RAPGPPYSPVPAESESLVNGNHTPQTATRGPSACASHS | ||||||
Compositional bias | 163-187 | Polar residues | ||||
Sequence: SESLVNGNHTPQTATRGPSACASHS | ||||||
Region | 211-334 | Disordered | ||||
Sequence: AAGKKPAATSPLSPMANGGRYLLSPPTSPGAMSVGSSYENTSPAFSPLSSPASSGSCASHSPSGQEPGPSVPPLVPARSSSYHLALQPPQSRPSGARSESPRLSRKGGHERPPSPGLRGLLTDS | ||||||
Compositional bias | 239-275 | Polar residues | ||||
Sequence: PGAMSVGSSYENTSPAFSPLSSPASSGSCASHSPSGQ | ||||||
Compositional bias | 293-308 | Polar residues | ||||
Sequence: HLALQPPQSRPSGARS | ||||||
Region | 370-535 | Disordered | ||||
Sequence: GALSQPTSIPGSPKFQPPVPAPRNKIGTLQDRPPSPFREPPGSERVLTTSPSRQLVGRTFSDGLATRTLQPPESPRLGRRGLDSMRELPPLSPSLSRRALSPLPTRTTPDPKLNREVAESPRPRRWAAHGASPEDFSLTLGARGRRTRSPSPTLGESLAPHKGSFS | ||||||
Compositional bias | 414-437 | Polar residues | ||||
Sequence: RVLTTSPSRQLVGRTFSDGLATRT | ||||||
Region | 653-707 | Disordered | ||||
Sequence: PSRGLAGASGRSSEEPGVATQRLWESMERSDEENLKEECSSTESTQQEHEDAPST | ||||||
Compositional bias | 677-707 | Basic and acidic residues | ||||
Sequence: ESMERSDEENLKEECSSTESTQQEHEDAPST | ||||||
Coiled coil | 683-809 | |||||
Sequence: DEENLKEECSSTESTQQEHEDAPSTKLQGEVLALEEERAQVLGHVEQLKVRVKELEQQLQESAREAEMERALLQGEREAERALLQKEQKAVDQLQEKLVALETGIQKERDKEAEALETETKLFEDLE | ||||||
Region | 936-1019 | Disordered | ||||
Sequence: TGPAAASPHSSPPPLPAKASRQLQVYRSKMDGEATSPLPRTRSGPLPSSSGSSSSSSQLSVATLGRSPSPKSALLTQNGTGSLP | ||||||
Compositional bias | 976-1019 | Polar residues | ||||
Sequence: TRSGPLPSSSGSSSSSSQLSVATLGRSPSPKSALLTQNGTGSLP | ||||||
Region | 1119-1138 | Disordered | ||||
Sequence: SMETSISTGGNSACSPDNMS | ||||||
Coiled coil | 1144-1208 | |||||
Sequence: DMGKIEEMEKMLKEAHAEKNRLMESREREMELRRQALEEERRRREQVERRLQSESARRQQLVEKE | ||||||
Domain | 1256-1370 | PH | ||||
Sequence: SKVCRGYLVKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVIYFQAIEEVYYDHLRSAAKKRFFRFTMVTESPNPALTFCVKTHDRLYYMVAPSAEAMRIWMDVIVTGAE |
Domain
The PH domain mediates the binding to phosphoinositides.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q86UU1-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- NoteMinor.
- Length1,377
- Mass (Da)151,162
- Last updated2003-06-01 v1
- ChecksumDA2829CC9C2ECD3D
Q86UU1-2
- Name2
- NoteMajor.
- Differences from canonical
- 913-959: Missing
- 1321-1331: Missing
Q86UU1-3
- Name3
- Differences from canonical
- 913-959: Missing
- 1042-1042: Q → E
- 1043-1377: Missing
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A087WTZ7 | A0A087WTZ7_HUMAN | PHLDB1 | 209 | ||
A0A087WZL0 | A0A087WZL0_HUMAN | PHLDB1 | 641 |
Sequence caution
Features
Showing features for compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 163-187 | Polar residues | ||||
Sequence: SESLVNGNHTPQTATRGPSACASHS | ||||||
Compositional bias | 239-275 | Polar residues | ||||
Sequence: PGAMSVGSSYENTSPAFSPLSSPASSGSCASHSPSGQ | ||||||
Compositional bias | 293-308 | Polar residues | ||||
Sequence: HLALQPPQSRPSGARS | ||||||
Compositional bias | 414-437 | Polar residues | ||||
Sequence: RVLTTSPSRQLVGRTFSDGLATRT | ||||||
Compositional bias | 677-707 | Basic and acidic residues | ||||
Sequence: ESMERSDEENLKEECSSTESTQQEHEDAPST | ||||||
Alternative sequence | VSP_016737 | 913-959 | in isoform 2 and isoform 3 | |||
Sequence: Missing | ||||||
Compositional bias | 976-1019 | Polar residues | ||||
Sequence: TRSGPLPSSSGSSSSSSQLSVATLGRSPSPKSALLTQNGTGSLP | ||||||
Alternative sequence | VSP_016738 | 1042 | in isoform 3 | |||
Sequence: Q → E | ||||||
Alternative sequence | VSP_016739 | 1043-1377 | in isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_016740 | 1321-1331 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB094090 EMBL· GenBank· DDBJ | BAC76044.1 EMBL· GenBank· DDBJ | mRNA | ||
AB014538 EMBL· GenBank· DDBJ | BAA31613.2 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK074070 EMBL· GenBank· DDBJ | BAB84896.2 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
EF445008 EMBL· GenBank· DDBJ | ACA06043.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
EF445008 EMBL· GenBank· DDBJ | ACA06041.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP000941 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AP002954 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471065 EMBL· GenBank· DDBJ | EAW67401.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC098586 EMBL· GenBank· DDBJ | AAH98586.1 EMBL· GenBank· DDBJ | mRNA |