Q86SQ7 · SDCG8_HUMAN
- ProteinSerologically defined colon cancer antigen 8
- GeneSDCCAG8
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids713 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a role in the establishment of cell polarity and epithelial lumen formation (By similarity).
Also plays an essential role in ciliogenesis and subsequent Hedgehog signaling pathway that requires the presence of intact primary cilia for pathway activation. Mechanistically, interacts with and mediates RABEP2 centrosomal localization which is critical for ciliogenesis (PubMed:27224062).
Also plays an essential role in ciliogenesis and subsequent Hedgehog signaling pathway that requires the presence of intact primary cilia for pathway activation. Mechanistically, interacts with and mediates RABEP2 centrosomal localization which is critical for ciliogenesis (PubMed:27224062).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell-cell junction | |
Cellular Component | centriolar satellite | |
Cellular Component | centriole | |
Cellular Component | centrosome | |
Cellular Component | ciliary basal body | |
Cellular Component | cytosol | |
Cellular Component | photoreceptor cell cilium | |
Biological Process | cell projection organization | |
Biological Process | centrosome cycle | |
Biological Process | establishment of cell polarity | |
Biological Process | microtubule organizing center organization | |
Biological Process | neuron migration | |
Biological Process | regulation of cilium assembly | |
Biological Process | tube formation |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSerologically defined colon cancer antigen 8
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ86SQ7
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Located at the distal ends of both centrioles and colocalizes to centrosomes throughout the cell cycle.
Isoform 2
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Senior-Loken syndrome 7 (SLSN7)
- Note
- DescriptionA renal-retinal disorder characterized by progressive wasting of the filtering unit of the kidney (nephronophthisis), with or without medullary cystic renal disease, and progressive eye disease. Typically this disorder becomes apparent during the first year of life.
- See alsoMIM:613615
Bardet-Biedl syndrome 16 (BBS16)
- Note
- DescriptionA syndrome characterized by usually severe pigmentary retinopathy, early-onset obesity, polydactyly, hypogenitalism, renal malformation and intellectual disability. Secondary features include diabetes mellitus, hypertension and congenital heart disease. Bardet-Biedl syndrome inheritance is autosomal recessive, but three mutated alleles (two at one locus, and a third at a second locus) may be required for clinical manifestation of some forms of the disease.
- See alsoMIM:615993
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_051333 | 378 | in dbSNP:rs2275155 | |||
Sequence: E → D |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1,426 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000076310 | 1-713 | UniProt | Serologically defined colon cancer antigen 8 | |||
Sequence: MAKSPENSTLEEILGQYQRSLREHASRSIHQLTCALKEGDVTIGEDAPNLSFSTSVGNEDARTAWPELQQSHAVNQLKDLLRQQADKESEVSPSRRRKMSPLRSLEHEETNMPTMHDLVHTINDQSQYIHHLEAEVKFCKEELSGMKNKIQVVVLENEGLQQQLKSQRQEETLREQTLLDASGNMHNSWITTGEDSGVGETSKRPFSHDNADFGKAASAGEQLELEKLKLTYEEKCEIEESQLKFLRNDLAEYQRTCEDLKEQLKHKEFLLAANTCNRVGGLCLKCAQHEAVLSQTHTNVHMQTIERLVKERDDLMSALVSVRSSLADTQQREASAYEQVKQVLQISEEANFEKTKALIQCDQLRKELERQAERLEKELASQQEKRAIEKDMMKKEITKEREYMGSKMLILSQNIAQLEAQVEKVTKEKISAINQLEEIQSQLASREMDVTKVCGEMRYQLNKTNMEKDEAEKEHREFRAKTNRDLEIKDQEIEKLRIELDESKQHLEQEQQKAALAREECLRLTELLGESEHQLHLTRQEKDSIQQSFSKEAKAQALQAQQREQELTQKIQQMEAQHDKTENEQYLLLTSQNTFLTKLKEECCTLAKKLEQISQKTRSEIAQLSQEKRYTYDKLGKLQRRNEELEEQCVQHGRVHETMKQRLRQLDKHSQATAQQLVQLLSKQNQLLLERQSLSEEVDRLRTQLPSMPQSDC | |||||||
Modified residue | 4 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 28 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 51 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 71 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 92 | PRIDE | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in thymus, prostate, testis, ovary, small intestine, colon, mucosa, colon and renal cancer tumors.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Homodimer (By similarity).
Interacts with OFD1; the interaction is direct (PubMed:20835237).
Interacts with FAM161A (PubMed:22940612).
Interacts with RABEP2, ERC1 and CEP131 (PubMed:27224062).
Interacts with OFD1; the interaction is direct (PubMed:20835237).
Interacts with FAM161A (PubMed:22940612).
Interacts with RABEP2, ERC1 and CEP131 (PubMed:27224062).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q86SQ7 | CEP131 Q9UPN4 | 3 | EBI-1047850, EBI-2558372 | |
XENO | Q86SQ7 | gag PRO_0000038593 P04591 | 2 | EBI-1047850, EBI-6179719 | |
BINARY | Q86SQ7 | RABEP2 Q9H5N1 | 5 | EBI-1047850, EBI-3940735 | |
BINARY | Q86SQ7-2 | ATN1 Q86V38 | 3 | EBI-10696955, EBI-11954292 | |
BINARY | Q86SQ7-2 | CHAT P28329-3 | 3 | EBI-10696955, EBI-25837549 | |
BINARY | Q86SQ7-2 | CRYAA P02489 | 3 | EBI-10696955, EBI-6875961 | |
BINARY | Q86SQ7-2 | FGFR3 P22607 | 3 | EBI-10696955, EBI-348399 | |
BINARY | Q86SQ7-2 | GIPC1 O14908-2 | 3 | EBI-10696955, EBI-25913156 | |
BINARY | Q86SQ7-2 | KLK6 Q92876 | 3 | EBI-10696955, EBI-2432309 | |
BINARY | Q86SQ7-2 | Q9Y649 | 3 | EBI-10696955, EBI-25900580 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 84-103 | Disordered | ||||
Sequence: QADKESEVSPSRRRKMSPLR | ||||||
Coiled coil | 129-175 | |||||
Sequence: IHHLEAEVKFCKEELSGMKNKIQVVVLENEGLQQQLKSQRQEETLRE | ||||||
Region | 194-215 | Disordered | ||||
Sequence: EDSGVGETSKRPFSHDNADFGK | ||||||
Region | 216-713 | Sufficient for homodimerization | ||||
Sequence: AASAGEQLELEKLKLTYEEKCEIEESQLKFLRNDLAEYQRTCEDLKEQLKHKEFLLAANTCNRVGGLCLKCAQHEAVLSQTHTNVHMQTIERLVKERDDLMSALVSVRSSLADTQQREASAYEQVKQVLQISEEANFEKTKALIQCDQLRKELERQAERLEKELASQQEKRAIEKDMMKKEITKEREYMGSKMLILSQNIAQLEAQVEKVTKEKISAINQLEEIQSQLASREMDVTKVCGEMRYQLNKTNMEKDEAEKEHREFRAKTNRDLEIKDQEIEKLRIELDESKQHLEQEQQKAALAREECLRLTELLGESEHQLHLTRQEKDSIQQSFSKEAKAQALQAQQREQELTQKIQQMEAQHDKTENEQYLLLTSQNTFLTKLKEECCTLAKKLEQISQKTRSEIAQLSQEKRYTYDKLGKLQRRNEELEEQCVQHGRVHETMKQRLRQLDKHSQATAQQLVQLLSKQNQLLLERQSLSEEVDRLRTQLPSMPQSDC | ||||||
Coiled coil | 223-273 | |||||
Sequence: LELEKLKLTYEEKCEIEESQLKFLRNDLAEYQRTCEDLKEQLKHKEFLLAA | ||||||
Coiled coil | 348-707 | |||||
Sequence: EEANFEKTKALIQCDQLRKELERQAERLEKELASQQEKRAIEKDMMKKEITKEREYMGSKMLILSQNIAQLEAQVEKVTKEKISAINQLEEIQSQLASREMDVTKVCGEMRYQLNKTNMEKDEAEKEHREFRAKTNRDLEIKDQEIEKLRIELDESKQHLEQEQQKAALAREECLRLTELLGESEHQLHLTRQEKDSIQQSFSKEAKAQALQAQQREQELTQKIQQMEAQHDKTENEQYLLLTSQNTFLTKLKEECCTLAKKLEQISQKTRSEIAQLSQEKRYTYDKLGKLQRRNEELEEQCVQHGRVHETMKQRLRQLDKHSQATAQQLVQLLSKQNQLLLERQSLSEEVDRLRTQLPS | ||||||
Region | 533-713 | Mediates interaction with OFD1 | ||||
Sequence: HQLHLTRQEKDSIQQSFSKEAKAQALQAQQREQELTQKIQQMEAQHDKTENEQYLLLTSQNTFLTKLKEECCTLAKKLEQISQKTRSEIAQLSQEKRYTYDKLGKLQRRNEELEEQCVQHGRVHETMKQRLRQLDKHSQATAQQLVQLLSKQNQLLLERQSLSEEVDRLRTQLPSMPQSDC |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 4 isoforms produced by Alternative splicing.
Q86SQ7-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Synonymsa
- Length713
- Mass (Da)82,682
- Last updated2003-06-01 v1
- Checksum04D5304DC3E17640
Q86SQ7-2
- Name2
- Synonymse
Q86SQ7-3
- Name3
Q86SQ7-4
- Name4
- Synonymsb
- Differences from canonical
- 183-226: Missing
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0G2JR20 | A0A0G2JR20_HUMAN | SDCCAG8 | 409 | ||
A0A0G2JQM2 | A0A0G2JQM2_HUMAN | SDCCAG8 | 525 | ||
A0A0G2JR50 | A0A0G2JR50_HUMAN | SDCCAG8 | 568 | ||
S4R323 | S4R323_HUMAN | SDCCAG8 | 155 | ||
A0A0C4DG71 | A0A0C4DG71_HUMAN | SDCCAG8 | 414 |
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_016949 | 183-226 | in isoform 4 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_016950 | 221-225 | in isoform 3 | |||
Sequence: EQLEL → LLDAS | ||||||
Alternative sequence | VSP_016951 | 357-360 | in isoform 2 | |||
Sequence: ALIQ → HPSQ | ||||||
Alternative sequence | VSP_016952 | 361-713 | in isoform 2 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_016953 | 538-616 | in isoform 3 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF250731 EMBL· GenBank· DDBJ | AAO27830.1 EMBL· GenBank· DDBJ | mRNA | ||
BC032454 EMBL· GenBank· DDBJ | AAH32454.1 EMBL· GenBank· DDBJ | mRNA | ||
BC045832 EMBL· GenBank· DDBJ | AAH45832.1 EMBL· GenBank· DDBJ | mRNA | ||
AF161348 EMBL· GenBank· DDBJ | AAF28908.1 EMBL· GenBank· DDBJ | mRNA | ||
AF039690 EMBL· GenBank· DDBJ | AAC18039.1 EMBL· GenBank· DDBJ | mRNA |