Q86SI9 · CEI_HUMAN
- ProteinPutative uncharacterized protein IRX2-DT
- GeneIRX2-DT
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids138 (go to sequence)
- Protein existenceUncertain
- Annotation score3/5
Function
Miscellaneous
According to PubMed:16515847, this gene is only represented in primates genome and it is highly conserved. Also found in bats (according to Ensembl).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePutative uncharacterized protein IRX2-DT
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ86SI9
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-35 | |||||
Sequence: MVAPAARVFLRAVRAALTSTVPDLLCLLARGSPRG | ||||||
Chain | PRO_5000090517 | 36-138 | Putative uncharacterized protein IRX2-DT | |||
Sequence: LASGRLPLAVHSAQHGPGSGAPWLRIARRALRFVLSKHWGDDCYLTNRLWQDLKPPSHVENGQELRLAPPVQWALQVQGNQLQTAVLCLRMAPPEPAGSRQRI |
Proteomic databases
PTM databases
Expression
Tissue specificity
Isoform 1 is highly expressed in small intestine, testis and kidney, medium expressed in brain and heart and low expressed in colon; it could not be detected in liver, adrenal gland and pancreas.
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q86SI9 | CIDEB Q9UHD4 | 3 | EBI-17872065, EBI-7062247 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence & Isoforms
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 3 isoforms produced by Alternative splicing.
Q86SI9-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsCEIa
- Length138
- Mass (Da)15,091
- Last updated2003-06-01 v1
- Checksum2F84F3ED685B3CE3
Q86SI9-2
- Name2
- SynonymsCEIb
- Differences from canonical
- 112-138: VQGNQLQTAVLCLRMAPPEPAGSRQRI → PKNLERVYVDTQVSASGDFLRGRARGTAGPGGSGSGSPRGRGRLRRPGRSPGAAPSSVSRGRKEATQARSRARGRRGGAVARVCRPESRQRWARPTSSPGGLIRGRRKNGIEAFQ
Q86SI9-3
- Name3
- SynonymsCEIc
- Differences from canonical
- 67-135: RFVLSKHWGDDCYLTNRLWQDLKPPSHVENGQELRLAPPVQWALQVQGNQLQTAVLCLRMAPPEPAGSR → S
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_026649 | 67-135 | in isoform 3 | |||
Sequence: RFVLSKHWGDDCYLTNRLWQDLKPPSHVENGQELRLAPPVQWALQVQGNQLQTAVLCLRMAPPEPAGSR → S | ||||||
Alternative sequence | VSP_026648 | 112-138 | in isoform 2 | |||
Sequence: VQGNQLQTAVLCLRMAPPEPAGSRQRI → PKNLERVYVDTQVSASGDFLRGRARGTAGPGGSGSGSPRGRGRLRRPGRSPGAAPSSVSRGRKEATQARSRARGRRGGAVARVCRPESRQRWARPTSSPGGLIRGRRKNGIEAFQ |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY249324 EMBL· GenBank· DDBJ | AAP15241.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY249325 EMBL· GenBank· DDBJ | AAP15242.1 EMBL· GenBank· DDBJ | mRNA | ||
BC101608 EMBL· GenBank· DDBJ | AAI01609.1 EMBL· GenBank· DDBJ | mRNA | ||
BC101634 EMBL· GenBank· DDBJ | AAI01635.1 EMBL· GenBank· DDBJ | mRNA |