Q86NK8 · Q86NK8_DROME
- Proteinnon-specific serine/threonine protein kinase
- Genegish
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids474 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Cellular Component | plasma membrane | |
Cellular Component | sperm individualization complex | |
Molecular Function | ATP binding | |
Molecular Function | protein serine/threonine kinase activity | |
Biological Process | endocytosis | |
Biological Process | glial cell migration | |
Biological Process | negative regulation of actin nucleation | |
Biological Process | olfactory learning | |
Biological Process | positive regulation of canonical Wnt signaling pathway | |
Biological Process | regulation of endocytic recycling | |
Biological Process | signal transduction | |
Biological Process | sperm individualization | |
Biological Process | Wnt signaling pathway |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namenon-specific serine/threonine protein kinase
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ86NK8
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-26 | Disordered | ||||
Sequence: MQRRERQASGGGPQTTTAGPSAGNVA | ||||||
Compositional bias | 7-26 | Polar residues | ||||
Sequence: QASGGGPQTTTAGPSAGNVA | ||||||
Domain | 62-352 | Protein kinase | ||||
Sequence: FRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAPDGIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWT | ||||||
Region | 389-443 | Disordered | ||||
Sequence: GVAAWPDVPKPGATLGNLTPADRHGSVQVVSSTNGELNPDDPTAGHSNTPITQQP | ||||||
Compositional bias | 412-443 | Polar residues | ||||
Sequence: HGSVQVVSSTNGELNPDDPTAGHSNTPITQQP |
Sequence similarities
Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. Casein kinase I subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length474
- Mass (Da)53,277
- Last updated2003-06-01 v1
- ChecksumF4E7D47028906D79
Computationally mapped potential isoform sequences
There are 12 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0B4KHL4 | A0A0B4KHL4_DROME | gish | 537 | ||
A0A0B4K697 | A0A0B4K697_DROME | gish | 521 | ||
A0A0B4K7C4 | A0A0B4K7C4_DROME | gish | 496 | ||
Q8INB6 | Q8INB6_DROME | gish | 427 | ||
A0A6H2EFD0 | A0A6H2EFD0_DROME | gish | 339 | ||
Q59DW8 | Q59DW8_DROME | gish | 463 | ||
Q4AB31 | Q4AB31_DROME | gish | 476 | ||
Q9VEX2 | Q9VEX2_DROME | gish | 422 | ||
Q86BR9 | Q86BR9_DROME | gish | 468 | ||
A0A6H2EGC1 | A0A6H2EGC1_DROME | gish | 399 | ||
Q8IHB0 | Q8IHB0_DROME | gish | 358 | ||
A0A6H2EFT7 | A0A6H2EFT7_DROME | gish | 448 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 7-26 | Polar residues | ||||
Sequence: QASGGGPQTTTAGPSAGNVA | ||||||
Compositional bias | 412-443 | Polar residues | ||||
Sequence: HGSVQVVSSTNGELNPDDPTAGHSNTPITQQP |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BT004871 EMBL· GenBank· DDBJ | AAO45227.1 EMBL· GenBank· DDBJ | mRNA | ||
AE014297 EMBL· GenBank· DDBJ | ACZ94924.1 EMBL· GenBank· DDBJ | Genomic DNA |