Q86BY9 · RIG_DROME
- ProteinGem-associated protein 5
- Generig
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1235 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the survival motor neuron (SMN) complex that catalyzes the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome, and thereby plays an important role in the splicing of cellular pre-mRNAs (PubMed:30563832).
Nuclear receptor cofactor for the ecdysone-regulated processes of molting and puparium formation (PubMed:14645129).
Acts downstream from ecdysone biosynthesis and release to control the expression of specific ecdysone-regulated genes such as Eip74EF (E74) (PubMed:14645129).
Essential in muscle and neuronal tissues for motor function, including climbing ability and flight (PubMed:24391840).
Nuclear receptor cofactor for the ecdysone-regulated processes of molting and puparium formation (PubMed:14645129).
Acts downstream from ecdysone biosynthesis and release to control the expression of specific ecdysone-regulated genes such as Eip74EF (E74) (PubMed:14645129).
Essential in muscle and neuronal tissues for motor function, including climbing ability and flight (PubMed:24391840).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytoplasmic U snRNP body | |
Cellular Component | nucleus | |
Cellular Component | SMN complex | |
Molecular Function | mRNA 3'-UTR binding | |
Biological Process | adult locomotory behavior | |
Biological Process | flight behavior | |
Biological Process | molting cycle, chitin-based cuticle | |
Biological Process | response to ecdysone | |
Biological Process | spliceosomal snRNP assembly |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGem-associated protein 5
- Short namesGemin5
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ86BY9
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Shuttles between the nucleus and cytoplasm at different stages of development.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Late larval lethal associated with molting defects at the 3rd instar stage (PubMed:26098872).
RNAi-mediated knockdown is late larval to adult lethal; the phenotype is the same if knockdown is restricted to muscle tissue, neuronal tissue or motor neuron cells (PubMed:24391840).
Conditional RNAi-mediated knockdown in the central nervous system or muscle tissue of adults results in age-dependent decline of motor functions, including climbing ability and flight (PubMed:24391840).
RNAi-mediated knockdown is late larval to adult lethal; the phenotype is the same if knockdown is restricted to muscle tissue, neuronal tissue or motor neuron cells (PubMed:24391840).
Conditional RNAi-mediated knockdown in the central nervous system or muscle tissue of adults results in age-dependent decline of motor functions, including climbing ability and flight (PubMed:24391840).
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000051199 | 1-1235 | Gem-associated protein 5 | |||
Sequence: MNSQVMYHNVPTPPGNVSLAAAAPDGGLLYAGIRCINYISAPPANGEQPQVVTMSTRINILALDVSPMWGLGNGGPTKPFAIVGDDLSVQVWDCALGEAVIGHKAHQHQHEARDVRVVHHTTNSVLMSYLANGNILSMDASDLVIYCVASNTYCRRSTFISPRNHQLTMVRCSPYNDNLFAVGTAMGNVLVCDLRKMNIVYKFHGHKAPICGLAWREVPAAEDEKTNNLALSAEEWRSRNGGQEEKPKTKPPPLTKSKAAESDDPFDIYNFDHLEYEFGAPIAERRRKSSEDCGGEFVGLEKPAGAAVLDFVEACESVKAELLASRQEDKTQHVEVTLHDCEPTKPTGPLSDASTISNKNDASDSTEGSLEVIQYSSSSDDAVIVDGEAAKPKREVLHHIYHQAEVHASGTPQTKSEPQSNLQVVPAISAETISLTSVNSTHLETLLVSIDGDEVMMIWNTNTGAHAGKNYSKSKTAGKLNNVYWLNNHVIVSLSRHQLFFWSVEFERKMLRYKISKDKSHSCHLQDIVSFACDSSKEMIWLCRNNRQIGMMNPKTGRMADFYGTVAFGVRAMAECPDDMNKIALGCSDRRVAFFDISKLTTSCLPIDSVYVSSNVYCLAWSPNCLELAFGTFDGTVGILDVERMKVKTHLRTPHKKEVYSLVWQDHFIYFIVNRVLGFFDLRKSKIEPTIVNCISRPSYLSIRDSFLFVGTDDGLLQIHERDSGMEKSWSPFIRQSALFARYVTDIAWCPLDSNKFAVSGNDRSVYVMEFQPTERNWKTLHTFTANTEKASITSMRWSHTQKHLLLTFHIEGKVCLWNCNAPEKPPLTITYHCPMWCGMFLPTNENIIMCSGKALSVELIDIKDALEGDEKSICPKVDALLNVKWASKSLTQPYAPVLTAAEKKRQRRDQRKAAAKLEVDVANKDQKKIQESVTAVIDNPTNDKCTQETPVEEMLEALSLDKEQNNRSAKECPKCKEQSPDSFTHSRTCLYLTQKELNKSALEKLAIVLTEDSAKIDKSVLISKLFSSKVMAKELIATELTNLKHSNTKDIAPLCLAMSTFKLREELEQHIANKTLTERHVSLAPSVSFTLWQDCCRAYAKQMEEKGYIMHAATYLFSQGMQSEAIKLFLANEYYKEALVHARICLPATDPLIKTVINNWLEHLEGTGNFAAAALICVLDNEMLRGYSYLRKYRNCTPEIADLMDQIKRIGQLGGVLDGCAPNEPIHNGSTAEH | ||||||
Modified residue | 289 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 290 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 351 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 354 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 355 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 357 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 411 | Phosphothreonine | ||||
Sequence: T |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the brain and salivary glands of early and late second instar larvae. Expressed in nurse cells and oocytes.
Developmental stage
During second and third instar larval development, it is localized primarily to the cytoplasm of cells in the brain and imaginal discs (tissues that are fated to form specific parts of the adult fly during metamorphosis). Also localized to the cytoplasm of larval salivary gland cells during the second and early third instar stages. It however, begins to shift into the nucleus of these cells in the mid-third instar maintaining this localization through the end of larval development. At puparium formation, it shuttles out of the nucleus of salivary gland cells to become more abundant in the cytoplasm. A similar dynamic movement occurs in cells of the larval midgut during third instar development.
Gene expression databases
Interaction
Subunit
Component of the core survival motor neuron (SMN) complex composed of Smn, Gem2, Gem3, rig/Gem5 and one of 3 almost identical Gem4 paralogs encoded by Glos/Gem4a, Gem4b or Gem4c (PubMed:30563832).
Interacts with nuclear receptors EcR, svp (seven up), usp (ultraspiracle), Hr39 and Hr3 (PubMed:14645129).
Interacts with nuclear receptors EcR, svp (seven up), usp (ultraspiracle), Hr39 and Hr3 (PubMed:14645129).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q86BY9 | Hr39 Q05192 | 2 | EBI-422757, EBI-75048 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for repeat, region, compositional bias, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 55-102 | WD 1 | ||||
Sequence: STRINILALDVSPMWGLGNGGPTKPFAIVGDDLSVQVWDCALGEAVIG | ||||||
Region | 227-263 | Disordered | ||||
Sequence: NNLALSAEEWRSRNGGQEEKPKTKPPPLTKSKAAESD | ||||||
Compositional bias | 238-252 | Basic and acidic residues | ||||
Sequence: SRNGGQEEKPKTKPP | ||||||
Region | 340-368 | Disordered | ||||
Sequence: DCEPTKPTGPLSDASTISNKNDASDSTEG | ||||||
Compositional bias | 348-368 | Polar residues | ||||
Sequence: GPLSDASTISNKNDASDSTEG | ||||||
Repeat | 428-469 | WD 2 | ||||
Sequence: ISAETISLTSVNSTHLETLLVSIDGDEVMMIWNTNTGAHAGK | ||||||
Motif | 443-447 | LXXLL motif | ||||
Sequence: LETLL | ||||||
Repeat | 475-512 | WD 3 | ||||
Sequence: KTAGKLNNVYWLNNHVIVSLSRHQLFFWSVEFERKMLR | ||||||
Repeat | 565-605 | WD 4 | ||||
Sequence: TVAFGVRAMAECPDDMNKIALGCSDRRVAFFDISKLTTSCL | ||||||
Repeat | 611-650 | WD 5 | ||||
Sequence: YVSSNVYCLAWSPNCLELAFGTFDGTVGILDVERMKVKTH | ||||||
Repeat | 690-730 | WD 6 | ||||
Sequence: TIVNCISRPSYLSIRDSFLFVGTDDGLLQIHERDSGMEKSW | ||||||
Repeat | 739-779 | WD 7 | ||||
Sequence: LFARYVTDIAWCPLDSNKFAVSGNDRSVYVMEFQPTERNWK | ||||||
Repeat | 788-828 | WD 8 | ||||
Sequence: TEKASITSMRWSHTQKHLLLTFHIEGKVCLWNCNAPEKPPL | ||||||
Compositional bias | 963-982 | Basic and acidic residues | ||||
Sequence: KEQNNRSAKECPKCKEQSPD | ||||||
Region | 963-983 | Disordered | ||||
Sequence: KEQNNRSAKECPKCKEQSPDS |
Domain
Contains one Leu-Xaa-Xaa-Leu-Leu (LXXLL) motif, which is usually essential for the association with nuclear receptors.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,235
- Mass (Da)137,829
- Last updated2003-06-01 v1
- Checksum015E185A6941F451
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 119 | in Ref. 4; AAO39440 | ||||
Sequence: H → N | ||||||
Sequence conflict | 126 | in Ref. 4; AAO39440 | ||||
Sequence: L → V | ||||||
Compositional bias | 238-252 | Basic and acidic residues | ||||
Sequence: SRNGGQEEKPKTKPP | ||||||
Sequence conflict | 321 | in Ref. 4; AAO39440 | ||||
Sequence: E → D | ||||||
Sequence conflict | 334 | in Ref. 4; AAO39440 | ||||
Sequence: V → L | ||||||
Compositional bias | 348-368 | Polar residues | ||||
Sequence: GPLSDASTISNKNDASDSTEG | ||||||
Sequence conflict | 364 | in Ref. 4; AAO39440 | ||||
Sequence: D → E | ||||||
Sequence conflict | 417 | in Ref. 4; AAO39440 | ||||
Sequence: E → K | ||||||
Sequence conflict | 516 | in Ref. 4; AAO39440 | ||||
Sequence: S → T | ||||||
Sequence conflict | 731 | in Ref. 4; AAO39440 | ||||
Sequence: S → T | ||||||
Sequence conflict | 764 | in Ref. 4; AAO39440 | ||||
Sequence: R → K | ||||||
Sequence conflict | 941 | in Ref. 4; AAO39440 | ||||
Sequence: P → S | ||||||
Sequence conflict | 947 | in Ref. 4; AAO39440 | ||||
Sequence: T → S | ||||||
Compositional bias | 963-982 | Basic and acidic residues | ||||
Sequence: KEQNNRSAKECPKCKEQSPD | ||||||
Sequence conflict | 1029 | in Ref. 4; AAO39440 | ||||
Sequence: S → T |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY274835 EMBL· GenBank· DDBJ | AAP31582.1 EMBL· GenBank· DDBJ | mRNA | ||
AE013599 EMBL· GenBank· DDBJ | AAF57440.3 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT003437 EMBL· GenBank· DDBJ | AAO39440.1 EMBL· GenBank· DDBJ | mRNA |