Q85439 · P8_RDVF
- ProteinOuter capsid protein P8
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids421 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Capsid protein which self-assembles to form the outer icosahedral capsid with a T=13 symmetry, about 70 nm in diameter and consisting of 780 molecules capsid proteins.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell cytoplasm | |
Cellular Component | host cell cytoplasmic vesicle | |
Cellular Component | viral envelope | |
Cellular Component | viral outer capsid | |
Molecular Function | host cell surface receptor binding | |
Molecular Function | structural molecule activity | |
Biological Process | fusion of virus membrane with host plasma membrane | |
Biological Process | modulation by virus of host process |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameOuter capsid protein P8
- Alternative names
- Cleaved into 2 chains
Organism names
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Duplornaviricota > Resentoviricetes > Reovirales > Sedoreoviridae > Phytoreovirus > Rice dwarf virus
- Virus hosts
Accessions
- Primary accessionQ85439
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Outer capsid protein P8
Note: Found in the peripheral regions of spherical cytoplasmic structures, called virus factories, that appear early after infection and are the site of viral replication and packaging.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000040672 | 1-362 | Outer capsid protein P8' | |||
Sequence: MSRQMWLDTSALLEAISEYVVRCNGDTFSGLTTGDFNALSNMFTQLSVSSAGYVSDPRVPLQTMSNMFVSFITSTDRCGYMLGKTWFNSDTKPTVSDDFITAYIKPRLQVPMSDTVRQLNNLSLQPSAKPKLYERQNAIMKGLDIPYSEPIEPCKLFRSVAGQTGNIPLMGILLTPPVAQQQPFFVAERRRILFGIRSNAAIPAGAYQFVVPAWASVLSVTGAYVYFTNSFFGTTIAGVTATATAADAATTFTVPTDANNLPVQTDSRLSFSLGGGNINLELGVAKTGFCVAIEGEFTILANRSQAYYTLNSITQTPTSIDDFDVSDFLTTFLSQLRACGQYEIFSDAMDQLTNNLITNYMD | ||||||
Chain | PRO_0000040671 | 1-421 | Outer capsid protein P8 | |||
Sequence: MSRQMWLDTSALLEAISEYVVRCNGDTFSGLTTGDFNALSNMFTQLSVSSAGYVSDPRVPLQTMSNMFVSFITSTDRCGYMLGKTWFNSDTKPTVSDDFITAYIKPRLQVPMSDTVRQLNNLSLQPSAKPKLYERQNAIMKGLDIPYSEPIEPCKLFRSVAGQTGNIPLMGILLTPPVAQQQPFFVAERRRILFGIRSNAAIPAGAYQFVVPAWASVLSVTGAYVYFTNSFFGTTIAGVTATATAADAATTFTVPTDANNLPVQTDSRLSFSLGGGNINLELGVAKTGFCVAIEGEFTILANRSQAYYTLNSITQTPTSIDDFDVSDFLTTFLSQLRACGQYEIFSDAMDQLTNNLITNYMDPPAIPAGLAFTSPWFRFSERARTILALQNVDLNIRKLMVRHLWVITSLIAVFGRYYRPN | ||||||
Chain | PRO_0000040673 | 363-421 | Small peptide 1 | |||
Sequence: PPAIPAGLAFTSPWFRFSERARTILALQNVDLNIRKLMVRHLWVITSLIAVFGRYYRPN |
Interaction
Subunit
Homotrimer (By similarity).
Homomultimer (By similarity).
Interacts with host peroxisomal glycolate oxidase (GOX). This interaction mediates its relocation to virus factories peripheral to host peroxisomes
Homomultimer (By similarity).
Interacts with host peroxisomal glycolate oxidase (GOX). This interaction mediates its relocation to virus factories peripheral to host peroxisomes
Sequence
- Sequence statusComplete
- Length421
- Mass (Da)46,424
- Last updated1996-11-01 v1
- ChecksumE1B6E34C52FEE235
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U36565 EMBL· GenBank· DDBJ | AAA88764.1 EMBL· GenBank· DDBJ | mRNA |