Q84XF3 · DRP1B_ARATH
- ProteinPhragmoplastin DRP1B
- GeneDRP1B
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids610 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Microtubule-associated force-producing protein that is targeted to at the leading edges of the forming cell plate during cytokinesis (PubMed:18612642).
Has a GTPase activity (By similarity).
Has a GTPase activity (By similarity).
Catalytic activity
- GTP + H2O = GDP + phosphate + H+
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytoskeleton | |
Cellular Component | microtubule | |
Cellular Component | phragmoplast | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePhragmoplastin DRP1B
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ84XF3
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Microtubule-associated and localized in the forming cell plate during cytokinesis, especially at the leading edges.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Modified residue | 1 | N-acetylmethionine | ||||
Sequence: M | ||||||
Chain | PRO_0000206578 | 1-610 | Phragmoplastin DRP1B | |||
Sequence: MESLIALVNKIQRACTALGDHGEGSSLPTLWDSLPAIAVVGGQSSGKSSVLESVVGKDFLPRGAGIVTRRPLVLQLHRIDEGKEYAEFMHLPKKKFTDFAAVRQEISDETDRETGRSSKVISTVPIHLSIFSPNVVNLTLVDLPGLTKVAVDGQPESIVQDIENMVRSFIEKPNCIILAISPANQDLATSDAIKISREVDPKGDRTFGVLTKIDLMDQGTNAVDILEGRGYKLRYPWVGVVNRSQADINKSVDMIAARRRERDYFQTSPEYRHLTERMGSEYLGKMLSKHLEVVIKSRIPGLQSLITKTISELETELSRLGKPVAADAGGKLYMIMEICRAFDQTFKEHLDGTRSGGEKINSVFDNQFPAAIKRLQFDKHLSMDNVRKLITEADGYQPHLIAPEQGYRRLIESCLVSIRGPAEAAVDAVHSILKDLIHKSMGETSELKQYPTLRVEVSGAAVDSLDRMRDESRKATLLLVDMESGYLTVEFFRKLPQDSEKGGNPTHSIFDRYNDAYLRRIGSNVLSYVNMVCAGLRNSIPKSIVYCQVREAKRSLLDIFFTELGQKEMSKLSKLLDEDPAVQQRRTSIAKRLELYRSAQTDIEAVAWSK |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 31-300 | Dynamin-type G | ||||
Sequence: WDSLPAIAVVGGQSSGKSSVLESVVGKDFLPRGAGIVTRRPLVLQLHRIDEGKEYAEFMHLPKKKFTDFAAVRQEISDETDRETGRSSKVISTVPIHLSIFSPNVVNLTLVDLPGLTKVAVDGQPESIVQDIENMVRSFIEKPNCIILAISPANQDLATSDAIKISREVDPKGDRTFGVLTKIDLMDQGTNAVDILEGRGYKLRYPWVGVVNRSQADINKSVDMIAARRRERDYFQTSPEYRHLTERMGSEYLGKMLSKHLEVVIKSRIP | ||||||
Region | 41-48 | G1 motif | ||||
Sequence: GGQSSGKS | ||||||
Region | 67-69 | G2 motif | ||||
Sequence: VTR | ||||||
Region | 142-145 | G3 motif | ||||
Sequence: DLPG | ||||||
Region | 211-214 | G4 motif | ||||
Sequence: TKID | ||||||
Region | 241-244 | G5 motif | ||||
Sequence: VNRS | ||||||
Domain | 518-610 | GED | ||||
Sequence: LRRIGSNVLSYVNMVCAGLRNSIPKSIVYCQVREAKRSLLDIFFTELGQKEMSKLSKLLDEDPAVQQRRTSIAKRLELYRSAQTDIEAVAWSK |
Sequence similarities
Belongs to the TRAFAC class dynamin-like GTPase superfamily. Dynamin/Fzo/YdjA family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length610
- Mass (Da)68,084
- Last updated2003-06-01 v1
- Checksum10B9C488898C9F5B
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1I9LMW6 | A0A1I9LMW6_ARATH | DL1B | 574 | ||
A0A1I9LMW7 | A0A1I9LMW7_ARATH | DL1B | 467 |
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY189279 EMBL· GenBank· DDBJ | AAO16682.1 EMBL· GenBank· DDBJ | mRNA | ||
AL132959 EMBL· GenBank· DDBJ | CAB71106.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002686 EMBL· GenBank· DDBJ | AEE80253.1 EMBL· GenBank· DDBJ | Genomic DNA |