Q84W41 · GLR36_ARATH
- ProteinGlutamate receptor 3.6
- GeneGLR3.6
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids903 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Glutamate-gated receptor that probably acts as a non-selective cation channel. Mediates leaf-to-leaf wound signaling. May be involved in light-signal transduction and calcium homeostasis via the regulation of calcium influx into cells.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane | |
Molecular Function | calcium channel activity | |
Molecular Function | glutamate receptor activity | |
Molecular Function | ligand-gated monoatomic ion channel activity | |
Biological Process | calcium ion transport | |
Biological Process | calcium-mediated signaling | |
Biological Process | cell-cell signaling | |
Biological Process | cellular response to amino acid stimulus | |
Biological Process | induced systemic resistance, jasmonic acid mediated signaling pathway | |
Biological Process | response to wounding |
Keywords
- Molecular function
- Biological process
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameGlutamate receptor 3.6
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ84W41
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 26-576 | Extracellular | ||||
Sequence: RPQVVNIGSVFTFNSLIGKVIKVAMDAAVEDVNASPSILNTTTLRIIMHDTKYNGFMSIMEPLQFMESETVAIIGPQRSTTARVVAHVATELKIPILSFSATDPTMSPLQFPFFIRTSQNDLFQMAAIADIVQFYGWREVVAIYGDDDYGRNGVAALGDRLSEKRCRISYKAALPPAPTRENITDLLIKVALSESRIIVVHASFIWGLELFNVARNLGMMSTGYVWIATNWLSTIIDTDSPLPLDTINNIQGVITLRLHTPNSIMKQNFVQRWHNLTHVGLSTYALYAYDTVWLLAQAIDDFFKKGGNVSFSKNPIISELGGGNLHLDALKVFDGGKIFLESILQVDRIGLTGRMKFTSDRNLVNPAFDVLNVIGTGYTTIGYWFNHSGLSVMPADEMENTSFSGQKLHSVVWPGHSIKIPRGWVFSNNGRHLRIGVPNRYRFEEVVSVKSNGMITGFCVDVFIAAINLLPYAVPFELVAFGNGHDNPSNSELVRLITTGVYDAGVGDITIITERTKMADFTQPYVESGLVVVAPVRKLGSSAMAFLRPFT | ||||||
Transmembrane | 577-597 | Helical | ||||
Sequence: PQMWLIAAASFLIVGAVIWCL | ||||||
Topological domain | 598-606 | Cytoplasmic | ||||
Sequence: EHKHNDEFR | ||||||
Transmembrane | 607-627 | Helical | ||||
Sequence: GPPRRQVITTFWFSFSTLFFS | ||||||
Topological domain | 628-638 | Cytoplasmic | ||||
Sequence: HRETTTSNLGR | ||||||
Transmembrane | 639-659 | Helical | ||||
Sequence: IVLIIWLFVVLIINSSYTASL | ||||||
Topological domain | 660-821 | Extracellular | ||||
Sequence: TSILTVHQLSSPIKGIETLQTNHDPIGYPQGSFVRDYLIHELNIHVSRLVPLRSPEEYDKALRDGPGKGGVAAVVDERAYIELFLSNRCEFGIVGQEFTKNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLLRKACSLQGAEIEVDRLELKSFWG | ||||||
Transmembrane | 822-842 | Helical | ||||
Sequence: LFVVCGVACVLALAVYTVLMI | ||||||
Topological domain | 843-903 | Cytoplasmic | ||||
Sequence: RQFGQQCPEEAEGSIRRRSSPSARIHSFLSFVKEKEEDAKARSSRERQLEDISANGSSRCN |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Reduced wound-activated surface potential changes (WASP) duration in the systemic leaves, resulting in a decreased induction of the regulators of jasmonate-signaling. Glr3.3 and glr3.6 double mutant has no detectable changes in surface potential in systemic leaves and the induction of the regulators of jasmonate-signaling is more strongly decreased.
Variants

We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 50 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-25 | |||||
Sequence: MKWFLLMLIICNAVPLQGLTKIVSA | ||||||
Chain | PRO_0000011610 | 26-903 | Glutamate receptor 3.6 | |||
Sequence: RPQVVNIGSVFTFNSLIGKVIKVAMDAAVEDVNASPSILNTTTLRIIMHDTKYNGFMSIMEPLQFMESETVAIIGPQRSTTARVVAHVATELKIPILSFSATDPTMSPLQFPFFIRTSQNDLFQMAAIADIVQFYGWREVVAIYGDDDYGRNGVAALGDRLSEKRCRISYKAALPPAPTRENITDLLIKVALSESRIIVVHASFIWGLELFNVARNLGMMSTGYVWIATNWLSTIIDTDSPLPLDTINNIQGVITLRLHTPNSIMKQNFVQRWHNLTHVGLSTYALYAYDTVWLLAQAIDDFFKKGGNVSFSKNPIISELGGGNLHLDALKVFDGGKIFLESILQVDRIGLTGRMKFTSDRNLVNPAFDVLNVIGTGYTTIGYWFNHSGLSVMPADEMENTSFSGQKLHSVVWPGHSIKIPRGWVFSNNGRHLRIGVPNRYRFEEVVSVKSNGMITGFCVDVFIAAINLLPYAVPFELVAFGNGHDNPSNSELVRLITTGVYDAGVGDITIITERTKMADFTQPYVESGLVVVAPVRKLGSSAMAFLRPFTPQMWLIAAASFLIVGAVIWCLEHKHNDEFRGPPRRQVITTFWFSFSTLFFSHRETTTSNLGRIVLIIWLFVVLIINSSYTASLTSILTVHQLSSPIKGIETLQTNHDPIGYPQGSFVRDYLIHELNIHVSRLVPLRSPEEYDKALRDGPGKGGVAAVVDERAYIELFLSNRCEFGIVGQEFTKNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLLRKACSLQGAEIEVDRLELKSFWGLFVVCGVACVLALAVYTVLMIRQFGQQCPEEAEGSIRRRSSPSARIHSFLSFVKEKEEDAKARSSRERQLEDISANGSSRCN | ||||||
Glycosylation | 65 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 207 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 300 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 333 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 411 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 425 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed predominantly in roots and siliques.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 881-903 | Disordered | ||||
Sequence: AKARSSRERQLEDISANGSSRCN |
Sequence similarities
Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length903
- Mass (Da)100,530
- Last updated2003-06-01 v1
- Checksum4070A8CFDCDEE580
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1I9LP22 | A0A1I9LP22_ARATH | GLR36 | 813 | ||
A0A1I9LP23 | A0A1I9LP23_ARATH | GLR36 | 777 |
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL133452 EMBL· GenBank· DDBJ | CAB63012.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002686 EMBL· GenBank· DDBJ | AEE78797.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002686 EMBL· GenBank· DDBJ | ANM64332.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT004264 EMBL· GenBank· DDBJ | AAO42266.1 EMBL· GenBank· DDBJ | mRNA |