Q84L33 · RD23B_ARATH
- ProteinUbiquitin receptor RAD23b
- GeneRAD23B
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids371 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May be involved in nucleotide excision repair (By similarity).
Binds and presumably selects ubiquitin-conjugates for destruction. Prefers multiubiquitin chains rather than single ubiquitins, with a binding affinity for 'Lys-48'-linked ubiquitin chains. Acts as a ubiquitin receptor that associates with the 26S proteasomal docking subunit RPN10 for the indirect recognition of ubiquitinated substrates of ubiquitin/26S proteasome-mediated proteolysis (UPP). Involved in UV tolerance in both roots and hypocotyls, specifically in dark conditions (PubMed:29283431).
Binds and presumably selects ubiquitin-conjugates for destruction. Prefers multiubiquitin chains rather than single ubiquitins, with a binding affinity for 'Lys-48'-linked ubiquitin chains. Acts as a ubiquitin receptor that associates with the 26S proteasomal docking subunit RPN10 for the indirect recognition of ubiquitinated substrates of ubiquitin/26S proteasome-mediated proteolysis (UPP). Involved in UV tolerance in both roots and hypocotyls, specifically in dark conditions (PubMed:29283431).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Molecular Function | damaged DNA binding | |
Molecular Function | polyubiquitin modification-dependent protein binding | |
Molecular Function | proteasome binding | |
Molecular Function | ubiquitin binding | |
Biological Process | nucleotide-excision repair | |
Biological Process | proteasome-mediated ubiquitin-dependent protein catabolic process | |
Biological Process | response to UV | |
Biological Process | UV protection |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameUbiquitin receptor RAD23b
- Short namesAtRAD23b
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ84L33
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Phenotypes & Variants
Disruption phenotype
Slow growth with abnormal phyllotaxy, shorter primary root with fewer lateral roots, shorter inflorescences, smaller siliques and reduced seed set, with unfertilized ovules interspersed among seeds of normal appearance. Mutant displays resistance to mitomycin C (MMC) (PubMed:20086187).
Increased UV sensitivity in both roots and hypocotyls, specifically in dark conditions (PubMed:29283431).
Increased UV sensitivity in both roots and hypocotyls, specifically in dark conditions (PubMed:29283431).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 47 | Abolishes interaction with RPN10. | ||||
Sequence: I → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 31 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000114908 | 1-371 | Ubiquitin receptor RAD23b | |||
Sequence: MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLVENKVTEEGFLVVMLSKSKSGGSAGQASVQTSSVSQPVSATTSSTKPAAPSTTQSSPVPASPIPAQEQPAAQTDTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRALRAAYNNPERAVDYLYSGIPQTAEVAVPVPEAQIAGSGAAPVAPASGGPNSSPLDLFPQETVAAAGSGDLGTLEFLRNNDQFQQLRTMVHSNPQILQPMLQELGKQNPQLLRLIQENQAEFLQLVNEPYEGSDGEGDMFDQPEQEMPHAINVTPAEQEAIQRLEAMGFDRALVIEAFLACDRNEELAANYLLENSGDFED |
Proteomic databases
Expression
Interaction
Subunit
Interacts with 'Lys-48'-linked polyubiquitin chains. Interacts with RPN10 via its ubiquitin-like domain. Interacts with UBQ1, UBQ2, UBQ5, UBQ7, UBQ10, UBQ11 and IAA16. Binds to RAD4 (PubMed:29283431).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q84L33 | VAL2 Q5CCK4 | 3 | EBI-20557876, EBI-15193683 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-79 | Ubiquitin-like | ||||
Sequence: MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLVENKVTEEGFLVVMLSKSKS | ||||||
Region | 79-142 | Disordered | ||||
Sequence: SGGSAGQASVQTSSVSQPVSATTSSTKPAAPSTTQSSPVPASPIPAQEQPAAQTDTYGQAASTL | ||||||
Domain | 146-189 | UBA 1 | ||||
Sequence: SSLEQMVQQIMEMGGGSWDKETVTRALRAAYNNPERAVDYLYSG | ||||||
Domain | 242-285 | STI1 | ||||
Sequence: GTLEFLRNNDQFQQLRTMVHSNPQILQPMLQELGKQNPQLLRLI | ||||||
Domain | 325-365 | UBA 2 | ||||
Sequence: PAEQEAIQRLEAMGFDRALVIEAFLACDRNEELAANYLLEN |
Sequence similarities
Belongs to the RAD23 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q84L33-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Synonymsalpha, RAD23bi
- Length371
- Mass (Da)39,747
- Last updated2005-08-16 v3
- Checksum081493086EA976E7
Q84L33-2
- Name2
- Synonymsbeta, RAD23bii
- Differences from canonical
- 89-94: Missing
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_011875 | 89-94 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 253-254 | in Ref. 1; BAC76389/BAC76390 | ||||
Sequence: FQ → LE |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB109193 EMBL· GenBank· DDBJ | BAC76389.1 EMBL· GenBank· DDBJ | mRNA | ||
AB109194 EMBL· GenBank· DDBJ | BAC76390.1 EMBL· GenBank· DDBJ | mRNA | ||
AC010793 EMBL· GenBank· DDBJ | AAF68123.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002684 EMBL· GenBank· DDBJ | AEE36279.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE36281.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY034912 EMBL· GenBank· DDBJ | AAK59419.1 EMBL· GenBank· DDBJ | mRNA | ||
AY063103 EMBL· GenBank· DDBJ | AAL34277.1 EMBL· GenBank· DDBJ | mRNA | ||
AY088037 EMBL· GenBank· DDBJ | AAM65583.1 EMBL· GenBank· DDBJ | mRNA |