Q80ZE5 · PAQR8_MOUSE
- ProteinMembrane progestin receptor beta
- GenePaqr8
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids354 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Plasma membrane progesterone (P4) receptor coupled to G proteins. Seems to act through a G(i) mediated pathway (By similarity).
May be involved in oocyte maturation (PubMed:12601167).
Also binds dehydroepiandrosterone (DHEA), pregnanolone, pregnenolone and allopregnanolone (By similarity).
May be involved in oocyte maturation (PubMed:12601167).
Also binds dehydroepiandrosterone (DHEA), pregnanolone, pregnenolone and allopregnanolone (By similarity).
Miscellaneous
Non-classical progesterone receptors involved in extranuclear signaling are classified in 2 groups: the class II progestin and adipoQ receptor (PAQR) family (also called mPRs) (PAQR5, PAQR6, PAQR7, PAQR8 and PAQR9) and the b5-like heme/steroid-binding protein family (also called MAPRs) (PGRMC1, PGRMC2, NENF and CYB5D2).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | Golgi apparatus | |
Cellular Component | plasma membrane | |
Molecular Function | nuclear steroid receptor activity | |
Molecular Function | steroid binding | |
Biological Process | oogenesis | |
Biological Process | response to steroid hormone |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameMembrane progestin receptor beta
- Short namesmPR beta
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ80ZE5
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Note: Colocalizes with a lysosomal protein CTSD/cathepsin D.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-76 | Cytoplasmic | ||||
Sequence: MTTAILERLSTLSMSGQQLRRLPKILEEGLPKMPCTVPETDVPQLFREPYIHAGYRPTGHEWRYYFFSLFQKHNEV | ||||||
Transmembrane | 77-97 | Helical; Name=1 | ||||
Sequence: VNVWTHLLAALAVLLRFWAFV | ||||||
Topological domain | 98-111 | Extracellular | ||||
Sequence: EAGALQWASPHTLP | ||||||
Transmembrane | 112-132 | Helical; Name=2 | ||||
Sequence: LLLFILSSITYLTCSLLAHLL | ||||||
Topological domain | 133-173 | Cytoplasmic | ||||
Sequence: QSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYE | ||||||
Transmembrane | 174-194 | Helical; Name=3 | ||||
Sequence: LFWIFFLPAAAFCGWLSCAGC | ||||||
Topological domain | 195-213 | Extracellular | ||||
Sequence: CYAKYRYRRPYPVMRKICQ | ||||||
Transmembrane | 214-234 | Helical; Name=4 | ||||
Sequence: VVPAGLAFVLDISPVAHRVAL | ||||||
Topological domain | 235-243 | Cytoplasmic | ||||
Sequence: CHLAGCQEQ | ||||||
Transmembrane | 244-264 | Helical; Name=5 | ||||
Sequence: AAWYHTLQILFFLVSAYFFSC | ||||||
Topological domain | 265-283 | Extracellular | ||||
Sequence: PVPEKYFPGSCDIVGHGHQ | ||||||
Transmembrane | 284-304 | Helical; Name=6 | ||||
Sequence: IFHAFLSVCTLSQLEAILLDY | ||||||
Topological domain | 305-315 | Cytoplasmic | ||||
Sequence: QGRHEIFLQRH | ||||||
Transmembrane | 316-336 | Helical; Name=7 | ||||
Sequence: GPLSVYSACLSFFVLAACSAA | ||||||
Topological domain | 337-354 | Extracellular | ||||
Sequence: TATLLRHKVKDRLIKKDS |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000218841 | 1-354 | Membrane progestin receptor beta | |||
Sequence: MTTAILERLSTLSMSGQQLRRLPKILEEGLPKMPCTVPETDVPQLFREPYIHAGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVEAGALQWASPHTLPLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYELFWIFFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFVLDISPVAHRVALCHLAGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSVCTLSQLEAILLDYQGRHEIFLQRHGPLSVYSACLSFFVLAACSAATATLLRHKVKDRLIKKDS |
Proteomic databases
PTM databases
Expression
Structure
Sequence
- Sequence statusComplete
- Length354
- Mass (Da)40,430
- Last updated2004-08-16 v2
- Checksum14544CBB3338B538
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 41 | in Ref. 3; AAR08385/BAC33221 | ||||
Sequence: D → G | ||||||
Sequence conflict | 116 | in Ref. 1; AAO47230 | ||||
Sequence: I → V | ||||||
Sequence conflict | 177 | in Ref. 1; AAO47230 | ||||
Sequence: I → L | ||||||
Sequence conflict | 339 | in Ref. 1; AAO47230 | ||||
Sequence: T → S |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF313617 EMBL· GenBank· DDBJ | AAO47230.1 EMBL· GenBank· DDBJ | mRNA | ||
AY424297 EMBL· GenBank· DDBJ | AAR08385.1 EMBL· GenBank· DDBJ | mRNA | ||
AK006107 EMBL· GenBank· DDBJ | BAB24412.1 EMBL· GenBank· DDBJ | mRNA | ||
AK029772 EMBL· GenBank· DDBJ | BAC26609.1 EMBL· GenBank· DDBJ | mRNA | ||
AK031969 EMBL· GenBank· DDBJ | BAC27629.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
AK048045 EMBL· GenBank· DDBJ | BAC33221.1 EMBL· GenBank· DDBJ | mRNA | ||
AK147376 EMBL· GenBank· DDBJ | BAE27872.1 EMBL· GenBank· DDBJ | mRNA | ||
BC059813 EMBL· GenBank· DDBJ | AAH59813.1 EMBL· GenBank· DDBJ | mRNA |