Q80Z64 · NANOG_MOUSE
- ProteinHomeobox protein NANOG
- GeneNanog
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids305 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Imposes pluripotency on ES cells and prevents their differentiation towards extraembryonic endoderm and trophectoderm lineages. Blocks bone morphogenetic protein-induced mesoderm differentiation of ES cells by physically interacting with SMAD1 and interfering with the recruitment of coactivators to the active SMAD transcriptional complexes. Acts as a transcriptional activator or repressor. Binds optimally to the DNA consensus sequence 5'-TAAT[GT][GT]-3' or 5'-[CG][GA][CG]C[GC]ATTAN[GC]-3'. Binds to the POU5F1/OCT4 promoter (By similarity).
Able to autorepress its expression in differentiating (ES) cells: binds to its own promoter following interaction with ZNF281/ZFP281, leading to recruitment of the NuRD complex and subsequent repression of expression. When overexpressed, promotes cells to enter into S phase and proliferation
Miscellaneous
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 96-155 | Homeobox | ||||
Sequence: KQKMRTVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Nanog promotes maintenance of H3K27me3 marks on repressed genes in the absence of the LIF cytokine in mouse embryonic stem cells. Nanog strongly represses Otx2, a differentiation-inducing transcription factor of mouse embryonic stem cells.
Names & Taxonomy
Protein names
- Recommended nameHomeobox protein NANOG
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ80Z64
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 101 | Decreased protein expression. Decreased embryonic stem cell self-renewal. | ||||
Sequence: T → A | ||||||
Mutagenesis | 103 | Decreased protein expression and stability. Decreased embryonic stem cell self-renewal. | ||||
Sequence: F → A | ||||||
Mutagenesis | 112 | Increases affinity for DNA and protein stability; when associated with R-147. | ||||
Sequence: K → E | ||||||
Mutagenesis | 120 | Decreased protein expression and stability. Decreased embryonic stem cell self-renewal. | ||||
Sequence: Y → A | ||||||
Mutagenesis | 123 | Increased protein expression and stability. | ||||
Sequence: L → A | ||||||
Mutagenesis | 125 | Decreased protein expression. No effect on protein stability. | ||||
Sequence: Q → A | ||||||
Mutagenesis | 126 | No effect on protein stability. | ||||
Sequence: M → A | ||||||
Mutagenesis | 126 | Increases affinity for DNA; when associated with E-137. | ||||
Sequence: M → R | ||||||
Mutagenesis | 137 | Increased protein expression. Decreased protein stability. | ||||
Sequence: Y → A | ||||||
Mutagenesis | 137 | Increases affinity for DNA; when associated with R-126. | ||||
Sequence: Y → E | ||||||
Mutagenesis | 138 | Decreased protein expression and stability. Decreased embryonic stem cell self-renewal. | ||||
Sequence: K → A | ||||||
Mutagenesis | 138 | Reduced affinity for DNA. | ||||
Sequence: K → E | ||||||
Mutagenesis | 141 | Decreased protein stability. | ||||
Sequence: K → A | ||||||
Mutagenesis | 142 | Decreased protein expression and stability. Decreased embryonic stem cell self-renewal. | ||||
Sequence: T → A | ||||||
Mutagenesis | 142 | Slightly reduced affinity for DNA. | ||||
Sequence: T → I | ||||||
Mutagenesis | 145 | Increased protein expression. No effect on protein stability. | ||||
Sequence: Q → A | ||||||
Mutagenesis | 146 | No effect on protein stability. Decreased embryonic stem cell self-renewal. | ||||
Sequence: N → A | ||||||
Mutagenesis | 146 | Strongly reduced affinity for DNA. | ||||
Sequence: N → E | ||||||
Mutagenesis | 147 | Increases affinity for DNA and protein stability; when associated with E-112. | ||||
Sequence: Q → R | ||||||
Mutagenesis | 148 | Decreased protein stability. Decreased embryonic stem cell self-renewal. | ||||
Sequence: R → A | ||||||
Mutagenesis | 149 | Increased protein expression. No effect on protein stability. | ||||
Sequence: M → A | ||||||
Mutagenesis | 152 | Decreased protein expression and stability. | ||||
Sequence: K → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 45 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000261419 | 1-305 | Homeobox protein NANOG | |||
Sequence: MSVGLPGPHSLPSSEEASNSGNASSMPAVFHPENYSCLQGSATEMLCTEAASPRPSSEDLPLQGSPDSSTSPKQKLSSPEADKGPEEEENKVLARKQKMRTVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQKNQWLKTSNGLIQKGSAPVEYPSIHCSYPQGYLVNASGSLSMWGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNGQPWNAAPLHNFGEDFLQPYVQLQQNFSASDLEVNLEATRESHAHFSTPQALELFLNYSVTPPGEI |
Proteomic databases
PTM databases
Expression
Tissue specificity
Induction
Developmental stage
Gene expression databases
Interaction
Subunit
Interacts with SALL4 (PubMed:16840789).
Interacts with ZNF281/ZFP281 (PubMed:21915945, PubMed:22988117).
Interacts with PCGF1 (By similarity).
Interacts with ESRRB; reciprocally modulates their transcriptional activities (PubMed:18957414).
Interacts with NSD2 (PubMed:19483677).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q80Z64 | Nr0b1 Q61066 | 7 | EBI-2312517, EBI-2312665 | |
BINARY | Q80Z64 | Pin1 Q9QUR7 | 2 | EBI-2312517, EBI-2432975 | |
BINARY | Q80Z64 | Pou5f1 P20263 | 4 | EBI-2312517, EBI-1606219 | |
BINARY | Q80Z64 | Rif1 Q6PR54 | 5 | EBI-2312517, EBI-2312621 | |
BINARY | Q80Z64 | Slc8a1 P70414 | 9 | EBI-2312517, EBI-2312694 | |
BINARY | Q80Z64 | Sox2 P48432 | 10 | EBI-2312517, EBI-2313612 | |
BINARY | Q80Z64 | Znf281 Q99LI5 | 5 | EBI-2312517, EBI-2312719 | |
BINARY | Q80Z64-1 | Nanog Q80Z64-1 | 2 | EBI-15699014, EBI-15699014 | |
XENO | Q80Z64-1 | PIN1 Q13526 | 2 | EBI-15699014, EBI-714158 | |
BINARY | Q80Z64-1 | Ubc P62991 | 3 | EBI-15699014, EBI-413074 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-30 | Disordered | ||||
Sequence: MSVGLPGPHSLPSSEEASNSGNASSMPAVF | ||||||
Compositional bias | 12-29 | Polar residues | ||||
Sequence: PSSEEASNSGNASSMPAV | ||||||
Region | 46-95 | Disordered | ||||
Sequence: LCTEAASPRPSSEDLPLQGSPDSSTSPKQKLSSPEADKGPEEEENKVLAR | ||||||
Compositional bias | 58-77 | Polar residues | ||||
Sequence: EDLPLQGSPDSSTSPKQKLS | ||||||
Compositional bias | 79-95 | Basic and acidic residues | ||||
Sequence: PEADKGPEEEENKVLAR | ||||||
Region | 96-155 | Sufficient for interaction with SALL4 | ||||
Sequence: KQKMRTVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ | ||||||
Region | 123-152 | Required for DNA-binding | ||||
Sequence: LQQMQELSSILNLSYKQVKTWFQNQRMKCK | ||||||
Repeat | 198-202 | 1 | ||||
Sequence: WGSQT | ||||||
Region | 198-247 | 10 X repeats starting with a Trp in each unit | ||||
Sequence: WGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNGQPWNAAP | ||||||
Region | 198-247 | Sufficient for transactivation activity | ||||
Sequence: WGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNGQPWNAAP | ||||||
Repeat | 203-207 | 2 | ||||
Sequence: WTNPT | ||||||
Repeat | 208-212 | 3 | ||||
Sequence: WSSQT | ||||||
Repeat | 213-217 | 4 | ||||
Sequence: WTNPT | ||||||
Repeat | 218-222 | 5 | ||||
Sequence: WNNQT | ||||||
Repeat | 223-227 | 6 | ||||
Sequence: WTNPT | ||||||
Repeat | 228-232 | 7 | ||||
Sequence: WSSQA | ||||||
Repeat | 233-237 | 8 | ||||
Sequence: WTAQS | ||||||
Repeat | 238-242 | 9 | ||||
Sequence: WNGQP | ||||||
Repeat | 243-247 | 10 | ||||
Sequence: WNAAP | ||||||
Region | 248-305 | Sufficient for strong transactivation activity | ||||
Sequence: LHNFGEDFLQPYVQLQQNFSASDLEVNLEATRESHAHFSTPQALELFLNYSVTPPGEI |
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q80Z64-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length305
- Mass (Da)34,240
- Last updated2003-06-01 v1
- Checksum4EF96408B767C79F
Q80Z64-2
- Name2
- SynonymsNanog1a, Nanog1b
- Differences from canonical
- 1-25: Missing
Features
Showing features for alternative sequence, compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_021689 | 1-25 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 12-29 | Polar residues | ||||
Sequence: PSSEEASNSGNASSMPAV | ||||||
Compositional bias | 58-77 | Polar residues | ||||
Sequence: EDLPLQGSPDSSTSPKQKLS | ||||||
Compositional bias | 79-95 | Basic and acidic residues | ||||
Sequence: PEADKGPEEEENKVLAR | ||||||
Sequence conflict | 149 | in Ref. 1; BAC76998 | ||||
Sequence: M → V |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB093574 EMBL· GenBank· DDBJ | BAC76998.1 EMBL· GenBank· DDBJ | mRNA | ||
AY278951 EMBL· GenBank· DDBJ | AAP92157.1 EMBL· GenBank· DDBJ | mRNA | ||
AF507043 EMBL· GenBank· DDBJ | AAO67362.1 EMBL· GenBank· DDBJ | mRNA | ||
AY455282 EMBL· GenBank· DDBJ | AAS57554.1 EMBL· GenBank· DDBJ | mRNA | ||
AY455285 EMBL· GenBank· DDBJ | AAS57556.1 EMBL· GenBank· DDBJ | mRNA | ||
AK010332 EMBL· GenBank· DDBJ | BAE43219.1 EMBL· GenBank· DDBJ | mRNA |