Q80UU9 · PGRC2_MOUSE
- ProteinMembrane-associated progesterone receptor component 2
- GenePgrmc2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids217 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Required for the maintenance of uterine histoarchitecture and normal female reproductive lifespan (PubMed:28005395).
May serve as a universal non-classical progesterone receptor in the uterus (Probable). Intracellular heme chaperone required for delivery of labile, or signaling heme, to the nucleus. Plays a role in adipocyte function and systemic glucose homeostasis. In brown fat, which has a high demand for heme, delivery of labile heme in the nucleus regulates the activity of heme-responsive transcriptional repressors such as NR1D1 and BACH1 (PubMed:31748741).
May serve as a universal non-classical progesterone receptor in the uterus (Probable). Intracellular heme chaperone required for delivery of labile, or signaling heme, to the nucleus. Plays a role in adipocyte function and systemic glucose homeostasis. In brown fat, which has a high demand for heme, delivery of labile heme in the nucleus regulates the activity of heme-responsive transcriptional repressors such as NR1D1 and BACH1 (PubMed:31748741).
Miscellaneous
Non-classical progesterone receptors involved in extranuclear signaling are classified in 2 groups: the class II progestin and adipoQ receptor (PAQR) family (also called mPRs) (PAQR5, PAQR6, PAQR7, PAQR8 and PAQR9) and the b5-like heme/steroid-binding protein family (also called MAPRs) (PGRMC1, PGRMC2, NENF and CYB5D2).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endomembrane system | |
Cellular Component | endoplasmic reticulum | |
Cellular Component | extracellular region | |
Cellular Component | glutamatergic synapse | |
Cellular Component | membrane | |
Cellular Component | nuclear envelope | |
Cellular Component | synapse | |
Molecular Function | heme binding | |
Molecular Function | heme transmembrane transporter activity | |
Molecular Function | steroid binding | |
Biological Process | adipose tissue development | |
Biological Process | heme transport |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameMembrane-associated progesterone receptor component 2
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ80UU9
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Single-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 40-62 | Helical | ||||
Sequence: ALLATGGEMLLNVALVALVLLGA |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Adipose tissue-specific knockout mice adapted to 30 degrees Celsius show no difference in body weight or white adipose tissue (WAT) mass but have reduced brown adipose tissue (BAT) weight relative to their wild-type littermates. BAT loses its distinctive reddish color. In contrast to wild-type mice, which activate thermogenesis and preserve body temperature when exposed to cold (4 degrees Celsius), mutants rapidly become hypothermic and die if not rescued. They have a total heme content reduced of about 60%. Mutants housed at room temperature and fed a high-fat diet (HFD) show no differences in body weight or composition, except for decreased BAT mass. However, they have higher fasting glycaemia and decreased glucose tolerance and insulin sensitivity. They also exhibit hyperlipidaemia and exacerbated liver steatosis with about 70% more triglycerides (PubMed:31748741).
Conditional knockout from female reproductive tissues results in postimplantation embryonic death leading to subfertility, with female mice producing 47% fewer pups/litter than wild-types. They undergo premature reproductive senescence by parities 2 to 5, producing 37.8% fewer litters overall during the trial compared with wild-types (PubMed:28005395).
Double conditional knockout for PGRMC1 and PGRMC2 from female reproductive tissues results in postimplantation embryonic death leading to subfertility, with female mice producing fewer pups/litter than wild-types. They undergo premature reproductive senescence, producing fewer litters overall during the trial compared with wild-types (PubMed:28005395).
Conditional knockout from female reproductive tissues results in postimplantation embryonic death leading to subfertility, with female mice producing 47% fewer pups/litter than wild-types. They undergo premature reproductive senescence by parities 2 to 5, producing 37.8% fewer litters overall during the trial compared with wild-types (PubMed:28005395).
Double conditional knockout for PGRMC1 and PGRMC2 from female reproductive tissues results in postimplantation embryonic death leading to subfertility, with female mice producing fewer pups/litter than wild-types. They undergo premature reproductive senescence, producing fewer litters overall during the trial compared with wild-types (PubMed:28005395).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 7 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, glycosylation, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000121744 | 1-217 | Membrane-associated progesterone receptor component 2 | |||
Sequence: MAAGDGDVKLSTLGSGGESGGDGSPGGAGATAARSSWVAALLATGGEMLLNVALVALVLLGAYRLWVRWGRRGLCSGPGAGEESPAATLPRMKKRDFSLEQLRQYDGARTPRILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHSKQD | ||||||
Glycosylation | 15 | O-linked (Xyl...) (chondroitin sulfate) serine | ||||
Sequence: S | ||||||
Modified residue | 84 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 98 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 202 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 204 | Phosphotyrosine | ||||
Sequence: Y | ||||||
Modified residue | 205 | Phosphothreonine | ||||
Sequence: T |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in brown adipose tissue, white adipose tissue, liver, heart, skeletal muscle, brain and adrenal gland.
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 96-195 | Cytochrome b5 heme-binding | ||||
Sequence: DFSLEQLRQYDGARTPRILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLL | ||||||
Region | 196-217 | Disordered | ||||
Sequence: KPGEEPSEYTDEEDTKDHSKQD |
Domain
The cytochrome b5 heme-binding domain lacks the conserved iron-binding His residues at positions 131 and 155.
Sequence similarities
Belongs to the cytochrome b5 family. MAPR subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length217
- Mass (Da)23,334
- Last updated2007-01-09 v2
- Checksum0291B0EFE8AD3403
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC100511 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC044759 EMBL· GenBank· DDBJ | AAH44759.1 EMBL· GenBank· DDBJ | mRNA |