Q80SV8 · Q80SV8_MOUSE
- ProteinNOD2
- GeneNod2
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids1013 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | basolateral plasma membrane | |
Cellular Component | cytoplasm | |
Cellular Component | lateral plasma membrane | |
Molecular Function | carbohydrate derivative binding | |
Biological Process | innate immune response | |
Biological Process | regulation of apoptotic process | |
Biological Process | regulation of cell communication | |
Biological Process | regulation of innate immune response | |
Biological Process | regulation of signaling |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ80SV8
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Lipid-anchor
Membrane ; Lipid-anchor
Keywords
- Cellular component
PTM/Processing
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-82 | CARD | ||||
Sequence: MCSQEEFQAQRSQLVALLISGSLEGFESILDWLLSWDVLSREDYEGLSLPGQPLSHSARRLLDTVWNKGVWGCQKLLEAVQE | ||||||
Domain | 107-178 | CARD | ||||
Sequence: LQSHRPAIVRRLYNHVEAMLELAREGGFLSQYECEEIRLPIFTSSQRARRLLDLAAVKANGLAAFLLQHVRE | ||||||
Domain | 266-402 | NACHT | ||||
Sequence: DTILVVGEAGSGKSTLLQRLHLLWATGRSFQEFLFIFPFSCRQLQCVAKPLSLRTLLFEHCCWPDVAQDDVFQFLLDHPDRVLLTFDGLDEFKFRFTDRERHCSPIDPTSVQTLLFNLLQGNLLKNACKVLTSRPDA |
Sequence similarities
Belongs to the NOD1-NOD2 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,013
- Mass (Da)112,804
- Last updated2003-06-01 v1
- Checksum9D41BA39FAC1905E
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AH012073 EMBL· GenBank· DDBJ | AAN57791.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY160380 EMBL· GenBank· DDBJ | AAN57791.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY160381 EMBL· GenBank· DDBJ | AAN57791.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY160382 EMBL· GenBank· DDBJ | AAN57791.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY160383 EMBL· GenBank· DDBJ | AAN57791.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY160384 EMBL· GenBank· DDBJ | AAN57791.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY160386 EMBL· GenBank· DDBJ | AAN57791.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY160387 EMBL· GenBank· DDBJ | AAN57791.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AH012079 EMBL· GenBank· DDBJ | AAN59994.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY160460 EMBL· GenBank· DDBJ | AAN59994.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY160461 EMBL· GenBank· DDBJ | AAN59994.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY160462 EMBL· GenBank· DDBJ | AAN59994.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY160463 EMBL· GenBank· DDBJ | AAN59994.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY160465 EMBL· GenBank· DDBJ | AAN59994.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY160466 EMBL· GenBank· DDBJ | AAN59994.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY160467 EMBL· GenBank· DDBJ | AAN59994.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AH012154 EMBL· GenBank· DDBJ | AAN63037.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY160630 EMBL· GenBank· DDBJ | AAN63037.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY160631 EMBL· GenBank· DDBJ | AAN63037.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY160632 EMBL· GenBank· DDBJ | AAN63037.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY160634 EMBL· GenBank· DDBJ | AAN63037.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY160635 EMBL· GenBank· DDBJ | AAN63037.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY160636 EMBL· GenBank· DDBJ | AAN63037.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY160637 EMBL· GenBank· DDBJ | AAN63037.1 EMBL· GenBank· DDBJ | Genomic DNA |