Q804H7 · BI52B_XENLA
- ProteinBaculoviral IAP repeat-containing protein 5.2-B
- Genebirc5.2-b
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids157 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Does not appear to exhibit anti-apoptotic activity. Plays a role in increasing blood vessel size during development (By similarity).
Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly
Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromosome passenger complex | |
Cellular Component | cytoplasm | |
Cellular Component | kinetochore | |
Cellular Component | midbody | |
Cellular Component | nucleus | |
Cellular Component | spindle | |
Molecular Function | metal ion binding | |
Molecular Function | nuclear retinoid X receptor binding | |
Biological Process | cell division | |
Biological Process | chromosome segregation | |
Biological Process | negative regulation of apoptotic process | |
Biological Process | negative regulation of DNA-templated transcription | |
Biological Process | protein phosphorylation | |
Biological Process | vasculature development |
Keywords
- Biological process
- Ligand
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameBaculoviral IAP repeat-containing protein 5.2-B
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Amphibia > Batrachia > Anura > Pipoidea > Pipidae > Xenopodinae > Xenopus > Xenopus
Accessions
- Primary accessionQ804H7
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes on chromosome arms and inner centromeres from prophase through metaphase and then transferring to the spindle midzone and midbody from anaphase through cytokinesis.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000382465 | 1-157 | Baculoviral IAP repeat-containing protein 5.2-B | |||
Sequence: MLSISPIVSLRRCDNEPSMPDEWRLYNLATRLRTFSNWPFTEDCACTPERMAEAGFVHCPTDNSPDVVKCFFCLKELEGWQPEDDPMDEHKKHSPSCLFIALKKKAEELTLSEFLKLDLEHMKIKMQKQMNLHIERFQAKANEVRGHLEKLDADETQ | ||||||
Modified residue | 47 | Phosphothreonine; by CDK1 | ||||
Sequence: T |
Post-translational modification
Ubiquitination is required for centrosome-targeting.
Keywords
- PTM
Expression
Tissue specificity
Exhibits strong and homogeneous expression in developing oocytes. In embryos, expressed in the animal hemisphere from one-cell to yolk plug stages, and highly expressed in the future brain and dorsal region of the neural tube at the neurula stage and early tail-bud stage. At tadpole stages, expression is restricted at a low level to the head region.
Developmental stage
Expressed both maternally and zygotically. In oocytes, expression gradually decreases throughout successive oocyte stages. Expression is maintained up to the larval stage (stage 35). Not expressed in adults, with the exception of expression in the ovary and weak expression in the testis.
Gene expression databases
Interaction
Subunit
Component of the CPC at least composed of survivin/birc5, incenp, cdca8/borealin and/or cdca9/dasra-A, and aurkb/aurora-B. Interacts directly with incenp (via N-terminus). Interacts with rxra; the interaction is stronger in the absence of 9-cis retinoic acids.
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 31-101 | BIR | ||||
Sequence: RLRTFSNWPFTEDCACTPERMAEAGFVHCPTDNSPDVVKCFFCLKELEGWQPEDDPMDEHKKHSPSCLFIA |
Domain
The BIR2 domain is required for vascular development.
Sequence similarities
Belongs to the IAP family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length157
- Mass (Da)18,341
- Last updated2009-09-01 v2
- Checksum1ED9C0B01E0AE627
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 122 | in Ref. 3; AAI69764/AAI69762 | ||||
Sequence: M → T |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY174765 EMBL· GenBank· DDBJ | AAO20085.1 EMBL· GenBank· DDBJ | mRNA | ||
AB197250 EMBL· GenBank· DDBJ | BAE02679.1 EMBL· GenBank· DDBJ | mRNA | ||
BC169762 EMBL· GenBank· DDBJ | AAI69762.1 EMBL· GenBank· DDBJ | mRNA | ||
BC169764 EMBL· GenBank· DDBJ | AAI69764.1 EMBL· GenBank· DDBJ | mRNA |