Q803T1 · Q803T1_DANRE
- ProteinDecorin
- Genedcn
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids373 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
May affect the rate of fibrils formation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Biological Process | cartilage development | |
Biological Process | chondroitin sulfate proteoglycan metabolic process | |
Biological Process | convergent extension involved in axis elongation |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDecorin
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionQ803T1
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-16 | |||||
Sequence: MKSACLSLLLVSVCWA | ||||||
Chain | PRO_5035035532 | 17-373 | Decorin | |||
Sequence: LPFRQSGFMDFVMEDEPASGDGPGPELPTTRKPHVERLPMMPEGPEVPFCPFRCQCHLRVAQCSDLGLKTVPEKIPLDTTLLDLQNNKITEIKENDFKGLKGLQTLILVNNKITIIHAKAFSSLINLERLYLSKNLLKEVPANIPKSLQELRIHENQINKIKKSSFAGMANVIVMELGSNPLSSSGVDNGAFADLKRVSYIRIADTNLTSIPKGLPSSLFELHLDGNKITKVTADSLKGLKNLSKLGLSHNEISVVENGSLANVPHLRELHLENNALTAVPAGLADHKYIQVIYLHSNKIAAVGTEDFCPPGYNTKKAMYSGISLFSNPVPYWEVLPITFRCVFDRSAIQLGNYRKK | ||||||
Disulfide bond | 66↔72 | |||||
Sequence: CPFRCQC | ||||||
Disulfide bond | 70↔79 | |||||
Sequence: CQCHLRVAQC | ||||||
Disulfide bond | 325↔358 | |||||
Sequence: CPPGYNTKKAMYSGISLFSNPVPYWEVLPITFRC |
Keywords
- PTM
Interaction
Subunit
Binds to type I and type II collagen, fibronectin and TGF-beta. Forms a ternary complex with MFAP2 and ELN.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q803T1 | pdgfrl F1QHI8 | 2 | EBI-42471462, EBI-42470033 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 65-97 | LRRNT | ||||
Sequence: FCPFRCQCHLRVAQCSDLGLKTVPEKIPLDTTL |
Sequence similarities
Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class I subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length373
- Mass (Da)41,211
- Last updated2003-06-01 v1
- Checksum25D4F8EFD05732E0
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC044206 EMBL· GenBank· DDBJ | AAH44206.1 EMBL· GenBank· DDBJ | mRNA | ||
AB906691 EMBL· GenBank· DDBJ | BAO48462.1 EMBL· GenBank· DDBJ | mRNA | ||
AB906692 EMBL· GenBank· DDBJ | BAO48463.1 EMBL· GenBank· DDBJ | mRNA | ||
AB906693 EMBL· GenBank· DDBJ | BAO48464.1 EMBL· GenBank· DDBJ | mRNA |