Q7ZYJ3 · AGK_XENLA
- ProteinAcylglycerol kinase, mitochondrial
- Geneagk
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids428 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Lipid kinase that can phosphorylate both monoacylglycerol and diacylglycerol to form lysophosphatidic acid (LPA) and phosphatidic acid (PA), respectively (By similarity).
Phosphorylates ceramide but not sphingosine (By similarity).
Phosphorylates 1,2-dioleoylglycerol more rapidly than 2,3-dioleoylglycerol (By similarity).
Independently of its lipid kinase activity, acts as a component of the TIM22 complex (By similarity).
The TIM22 complex mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane by forming a twin-pore translocase that uses the membrane potential as the external driving force (By similarity).
Phosphorylates ceramide but not sphingosine (By similarity).
Phosphorylates 1,2-dioleoylglycerol more rapidly than 2,3-dioleoylglycerol (By similarity).
Independently of its lipid kinase activity, acts as a component of the TIM22 complex (By similarity).
The TIM22 complex mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane by forming a twin-pore translocase that uses the membrane potential as the external driving force (By similarity).
Catalytic activity
- a monoacylglycerol + ATP = ADP + H+ + monoacyl-sn-glycero-3-phosphateThis reaction proceeds in the forward direction.
- 1-(9Z-octadecenoyl)-sn-glycerol + ATP = 1-(9Z-octadecenoyl)-sn-glycero-3-phosphate + ADP + H+This reaction proceeds in the forward direction.
- 1,2-di-(9Z-octadecenoyl)-sn-glycerol + ATP = 1,2-di-(9Z-octadecenoyl)-sn-glycero-3-phosphate + ADP + H+This reaction proceeds in the forward direction.
- a 1-acyl-sn-glycerol + ATP = a 1-acyl-sn-glycero-3-phosphate + ADP + H+This reaction proceeds in the forward direction.
- 1-hexadecanoyl-sn-glycerol + ATP = 1-hexadecanoyl-sn-glycero-3-phosphate + ADP + H+This reaction proceeds in the forward direction.
- a 2-acylglycerol + ATP = a 2-acyl-sn-glycerol 3-phosphate + ADP + H+This reaction proceeds in the forward direction.
- 2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-glycerol + ATP = 2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycero-3-phosphate + ADP + H+This reaction proceeds in the forward direction.
- 1-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycerol + ATP = 1-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycero-3-phosphate + ADP + H+This reaction proceeds in the forward direction.
- ATP + N-(hexanoyl)sphing-4-enine = ADP + H+ + N-hexanoylsphing-4-enine 1-phosphateThis reaction proceeds in the forward direction.
Cofactor
Pathway
Lipid metabolism; glycerolipid metabolism.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Cellular Component | mitochondrial intermembrane space | |
Cellular Component | mitochondrial membrane | |
Cellular Component | TIM22 mitochondrial import inner membrane insertion complex | |
Molecular Function | acylglycerol kinase activity | |
Molecular Function | ATP binding | |
Molecular Function | ATP-dependent diacylglycerol kinase activity | |
Molecular Function | ceramide kinase activity | |
Molecular Function | dihydroceramide kinase activity | |
Biological Process | glycerolipid metabolic process | |
Biological Process | protein insertion into mitochondrial inner membrane |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAcylglycerol kinase, mitochondrial
- EC number
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Amphibia > Batrachia > Anura > Pipoidea > Pipidae > Xenopodinae > Xenopus > Xenopus
Accessions
- Primary accessionQ7ZYJ3
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Peripheral membrane protein
Note: Localizes in the mitochondrion intermembrane space, where it associates with the inner membrane. It is unclear whether the N-terminal hydrophobic region forms a transmembrane region or associates with the membrane without crossing it.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000252384 | 1-428 | Acylglycerol kinase, mitochondrial | |||
Sequence: MARVVRIFKTLRNHWKKSTVGFCLLAYGSHWLYGKHCDNLLRRAACEEAQVFGNHQILPHSAIKKATVFLNPAACKGKARTLFEKNAAPVLHLAGIDITVVKTDYEGQAKKLLELMEKTDLIIVAGGDGTVQEVITGLLRRDDEASFSKIPIGFIPLGGTNTLSHTLYPERENKVEQITEATLSILKGETVPLDVLQIKGEQDQPVFAVQGIRWGSYRDASVKVSKYWYLGPLKARAAHLFSALKEWPQQHQASISYLGPAERPPEEPEQKPSRPPLYVRIYRRLALYWSPPKVEVPVEPTPEPWEEAQLSAVELSITTQNHQPDLLRTLDSMSIHIEPDTISKGKFIQLGAQKMTDPLLHPEDSQVLLASRCSLHLPQGTEGHFSIDSEEYEAMSVDVTLLPRKLHFLCHPTRKQELLQSPTATAQS |
Expression
Gene expression databases
Interaction
Subunit
Component of the TIM22 complex.
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 18-34 | Hydrophobic | ||||
Sequence: STVGFCLLAYGSHWLYG | ||||||
Domain | 61-202 | DAGKc | ||||
Sequence: SAIKKATVFLNPAACKGKARTLFEKNAAPVLHLAGIDITVVKTDYEGQAKKLLELMEKTDLIIVAGGDGTVQEVITGLLRRDDEASFSKIPIGFIPLGGTNTLSHTLYPERENKVEQITEATLSILKGETVPLDVLQIKGEQ |
Sequence similarities
Belongs to the AGK family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length428
- Mass (Da)47,962
- Last updated2003-06-01 v1
- Checksum5B883EF39E042922
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC043761 EMBL· GenBank· DDBJ | AAH43761.1 EMBL· GenBank· DDBJ | mRNA |