Q7ZWC6 · Q7ZWC6_DANRE
- ProteinUpstream stimulatory factor 1
- Geneusf1
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids309 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | protein dimerization activity | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameUpstream stimulatory factor 1
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionQ7ZWC6
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-28 | Disordered | ||||
Sequence: MKGQPKSSEPDVSVPVIEEGAVATAEDP | ||||||
Compositional bias | 173-189 | Polar residues | ||||
Sequence: NQRSIAPRTQAYNAKSE | ||||||
Region | 173-209 | Disordered | ||||
Sequence: NQRSIAPRTQAYNAKSEGPRTSRDEKRRAQHNEVERR | ||||||
Compositional bias | 190-209 | Basic and acidic residues | ||||
Sequence: GPRTSRDEKRRAQHNEVERR | ||||||
Domain | 198-253 | BHLH | ||||
Sequence: KRRAQHNEVERRRRDKINNWIVQLSKTIPDCTIDSTKTGQSKGGILSKACDYIQEL | ||||||
Coiled coil | 250-294 | |||||
Sequence: IQELRQSNSRLGDELNSIERLRMDNQLLRQEVEDWKSKNQILRNQ |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length309
- Mass (Da)33,531
- Last updated2003-06-01 v1
- Checksum61F51CF037871018
Computationally mapped potential isoform sequences
There are 8 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
F1QUA1 | F1QUA1_DANRE | usf1 | 309 | ||
A0A8M9Q076 | A0A8M9Q076_DANRE | usf1 | 293 | ||
A0A8M2B3M5 | A0A8M2B3M5_DANRE | usf1 | 288 | ||
A0A8M2B4B2 | A0A8M2B4B2_DANRE | usf1 | 298 | ||
A0A8M2B4D0 | A0A8M2B4D0_DANRE | usf1 | 299 | ||
A0A8M3APR4 | A0A8M3APR4_DANRE | usf1 | 307 | ||
A0A8M3B0Z9 | A0A8M3B0Z9_DANRE | usf1 | 297 | ||
A0A8M9QLB1 | A0A8M9QLB1_DANRE | usf1 | 303 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 173-189 | Polar residues | ||||
Sequence: NQRSIAPRTQAYNAKSE | ||||||
Compositional bias | 190-209 | Basic and acidic residues | ||||
Sequence: GPRTSRDEKRRAQHNEVERR |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC049481 EMBL· GenBank· DDBJ | AAH49481.1 EMBL· GenBank· DDBJ | mRNA |