Q7Z094 · I1BA_CONRA
- ProteinIota-conotoxin RXIA
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Iota-conotoxins bind to voltage-gated sodium channels and act as agonists by shifting the voltage-dependence of activation to more hyperpolarized levels. This toxin acts on Nav1.6/SCN8A > Nav1.2/SCN2A > Nav1.7/SCN9A sodium channels. Produces general excitatory symptoms upon intracorporeal injection and repetitive action potentials in the frog cutaneous pectoris muscle. Natural peptide (with D-Phe) is active on nerve, but not on muscle. Synthetic peptide (with L-Phe) is not active on both nerve and muscle.
Miscellaneous
Negative results: does not have effect on sodium channels Nav1.1/SCN1A, Nav1.3/SCN3A, Nav1.4/SCN4A, Nav1.5/SCN5A and on potassium channels Kv7.2/KCNQ2, Kv7.3/KCNQ3, Kv1.2/KCNA2, Kv1.3/KCNA3, Kv1.4/KCNA4, Kv1.5/KCNA5 and Kv1.6/KCNA6 (PubMed:17696362, PubMed:18486102).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | sodium channel regulator activity | |
Molecular Function | toxin activity |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameIota-conotoxin RXIA
- Alternative names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Spiralia > Lophotrochozoa > Mollusca > Gastropoda > Caenogastropoda > Neogastropoda > Conoidea > Conidae > Conus > Phasmoconus
Accessions
- Primary accessionQ7Z094
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000086868 | 1-46 | Iota-conotoxin RXIA | |||
Sequence: GPSFCKADEKPCEYHADCCNCCLSGICAPSTNWILPGCSTSSFFKI | ||||||
Modified residue | 2 | 4-hydroxyproline; partial | ||||
Sequence: P | ||||||
Disulfide bond | 5↔19 | |||||
Sequence: CKADEKPCEYHADCC | ||||||
Modified residue | 11 | 4-hydroxyproline; partial | ||||
Sequence: P | ||||||
Disulfide bond | 12↔22 | |||||
Sequence: CEYHADCCNCC | ||||||
Disulfide bond | 18↔27 | |||||
Sequence: CCNCCLSGIC | ||||||
Disulfide bond | 21↔38 | |||||
Sequence: CCLSGICAPSTNWILPGC | ||||||
Modified residue | 29 | 4-hydroxyproline | ||||
Sequence: P | ||||||
Modified residue | 44 | D-phenylalanine | ||||
Sequence: F |
Post-translational modification
The natural D-Phe-44 form of the peptide is more potent than the L-Phe-44 form.
Keywords
- PTM
Expression
Tissue specificity
Expressed by the venom duct.
Structure
Sequence
- Sequence statusComplete
- Length46
- Mass (Da)4,936
- Last updated2003-10-01 v1
- Checksum32C2812A24D82675
Mass Spectrometry
Keywords
- Technical term