Q7YS70 · MECR_BOVIN
- ProteinEnoyl-[acyl-carrier-protein] reductase, mitochondrial
- GeneMECR
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids373 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Catalyzes the NADPH-dependent reduction of trans-2-enoyl thioesters in mitochondrial fatty acid synthesis (fatty acid synthesis type II) (PubMed:12654921).
Fatty acid chain elongation in mitochondria uses acyl carrier protein (ACP) as an acyl group carrier, but the enzyme accepts both ACP and CoA thioesters as substrates in vitro. Displays a preference for medium-chain over short- and long-chain substrates (By similarity).
May provide the octanoyl chain used for lipoic acid biosynthesis, regulating protein lipoylation and mitochondrial respiratory activity particularly in Purkinje cells (By similarity).
Involved in iron homeostasis; affecting Fe-S cluster assembly and ceramide metabolism (By similarity).
Required for proper morphology and bioenergetic functions of mitochondria (By similarity).
Required for maintenance of neurons (By similarity).
Fatty acid chain elongation in mitochondria uses acyl carrier protein (ACP) as an acyl group carrier, but the enzyme accepts both ACP and CoA thioesters as substrates in vitro. Displays a preference for medium-chain over short- and long-chain substrates (By similarity).
May provide the octanoyl chain used for lipoic acid biosynthesis, regulating protein lipoylation and mitochondrial respiratory activity particularly in Purkinje cells (By similarity).
Involved in iron homeostasis; affecting Fe-S cluster assembly and ceramide metabolism (By similarity).
Required for proper morphology and bioenergetic functions of mitochondria (By similarity).
Required for maintenance of neurons (By similarity).
Catalytic activity
- a 2,3-saturated acyl-[ACP] + NADP+ = a (2E)-enoyl-[ACP] + H+ + NADPHThis reaction proceeds in the backward direction.
- (2E)-butenoyl-[ACP] + H+ + NADPH = butanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (2E)-hexenoyl-[ACP] + H+ + NADPH = hexanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (2E)-octenoyl-[ACP] + H+ + NADPH = NADP+ + octanoyl-[ACP]This reaction proceeds in the forward direction.
- (2E)-decenoyl-[ACP] + H+ + NADPH = decanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (2E)-dodecenoyl-[ACP] + H+ + NADPH = dodecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (2E)-tetradecenoyl-[ACP] + H+ + NADPH = NADP+ + tetradecanoyl-[ACP]This reaction proceeds in the forward direction.
- (2E)-hexadecenoyl-[ACP] + H+ + NADPH = hexadecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
Features
Showing features for active site, binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 94 | Proton donor | ||||
Sequence: Y | ||||||
Binding site | 167 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 193-196 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: NSGV | ||||||
Binding site | 216-218 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: RDT | ||||||
Binding site | 285-288 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: YGGM | ||||||
Binding site | 310-312 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: FWL | ||||||
Binding site | 368 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: K |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrion | |
Molecular Function | enoyl-[acyl-carrier-protein] reductase (NADPH) activity | |
Biological Process | ceramide biosynthetic process | |
Biological Process | fatty acid biosynthetic process | |
Biological Process | fatty acid metabolic process | |
Biological Process | intracellular iron ion homeostasis |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameEnoyl-[acyl-carrier-protein] reductase, mitochondrial
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Artiodactyla > Ruminantia > Pecora > Bovidae > Bovinae > Bos
Accessions
- Primary accessionQ7YS70
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for transit peptide, chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-53 | Mitochondrion | ||||
Sequence: MWVCGALCRTRAPAQLGQRLLPESRRRRPASASFSASAEPSRVRALVYGHHGD | ||||||
Chain | PRO_0000000887 | 54-373 | Enoyl-[acyl-carrier-protein] reductase, mitochondrial | |||
Sequence: PAKVVELKNLELAAVGGSHVHVKMLAAPINPSDINMIQGNYGLLPQLPAVGGNEGVGQVVAVGSGVTGVKPGDWVIPANPGLGTWRTEAVFGEEELITVPSDIPLQSAATLGVNPCTAYRMLVDFERLRPRDSIIQNASNSGVGQAVIQIAAARGLRTINVLRDTPDLQKLTDTLKNLGANHVVTEEELRKPEMKSFFKDVPQPRLALNCVGGKSSTELLRHLAPGGTMVTYGGMAKQPVIASVSQLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSEVPLQDYLCALEASTQPFVSSKQILTM | ||||||
Modified residue | 61 | N6-acetyllysine; alternate | ||||
Sequence: K | ||||||
Modified residue | 61 | N6-succinyllysine; alternate | ||||
Sequence: K | ||||||
Modified residue | 252 | N6-acetyllysine; alternate | ||||
Sequence: K | ||||||
Modified residue | 252 | N6-succinyllysine; alternate | ||||
Sequence: K | ||||||
Modified residue | 267 | N6-acetyllysine; alternate | ||||
Sequence: K | ||||||
Modified residue | 267 | N6-succinyllysine; alternate | ||||
Sequence: K | ||||||
Modified residue | 316 | N6-succinyllysine | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
Interaction
Structure
Family & Domains
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length373
- Mass (Da)40,275
- Last updated2003-10-01 v1
- Checksum7921122C7735A95D
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY256973 EMBL· GenBank· DDBJ | AAP45003.1 EMBL· GenBank· DDBJ | mRNA |