Q7XYH5 · Q7XYH5_CAPAN
- ProteinGlycerol-3-phosphate acyltransferase, chloroplastic
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids463 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
function
Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate. The enzyme from chilling-resistant plants discriminates against non-fluid palmitic acid and selects oleic acid whereas the enzyme from sensitive plants accepts both fatty acids.
Catalytic activity
- an acyl-CoA + sn-glycerol 3-phosphate = a 1-acyl-sn-glycero-3-phosphate + CoA
Pathway
Lipid metabolism.
Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 1/3.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast stroma | |
Molecular Function | glycerol-3-phosphate O-acyltransferase activity | |
Molecular Function | sn-1-glycerol-3-phosphate C16:0-DCA-CoA acyl transferase activity | |
Biological Process | CDP-diacylglycerol biosynthetic process | |
Biological Process | phosphatidylglycerol biosynthetic process |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGlycerol-3-phosphate acyltransferase, chloroplastic
- EC number
- Short namesGPAT
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > asterids > lamiids > Solanales > Solanaceae > Solanoideae > Capsiceae > Capsicum
Accessions
- Primary accessionQ7XYH5
Subcellular Location
Structure
Family & Domains
Features
Showing features for domain, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 228-374 | Phospholipid/glycerol acyltransferase | ||||
Sequence: VVLMSNHQSEADPAIIALLLELKHPDIAENIIYVAGDRVITDPLCKPFSMGRNLLCVYSKKHMNDDPELADMKKRANTRSLKEMAMLLRGGSKLIWIAPSGGRDRPDPVTKEWSPAPFDASATDNMRRLVEHAGVPGHIYPLAILCY | ||||||
Motif | 234-239 | HXXXXD motif | ||||
Sequence: HQSEAD |
Sequence similarities
Belongs to the GPAT/DAPAT family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length463
- Mass (Da)50,993
- Last updated2004-07-05 v2
- Checksum85405EB22D17CC5D
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY318749 EMBL· GenBank· DDBJ | AAP79443.2 EMBL· GenBank· DDBJ | mRNA |