Q7XTH4 · GUN11_ORYSJ
- ProteinEndoglucanase 11
- GeneGLU4
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids500 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
Catalytic activity
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 91 | Nucleophile | ||||
Sequence: D | ||||||
Active site | 417 | |||||
Sequence: H | ||||||
Active site | 469 | |||||
Sequence: D | ||||||
Active site | 478 | |||||
Sequence: E |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | cellulase activity | |
Biological Process | cell wall organization | |
Biological Process | cellulose catabolic process |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameEndoglucanase 11
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ7XTH4
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-30 | |||||
Sequence: MSPSSSSSSWRALVLVAAAVLSFSGHVVVA | ||||||
Chain | PRO_0000249288 | 31-500 | Endoglucanase 11 | |||
Sequence: AAAAGHPDYADALAKSILFFQGQRSGRLPPDQAVKWRSNSGLSDGSAANVDLTGGYYDGGDNVKFGFPMAFTTTMLSWGVVEYGGRMRGRVLRDARDAVRWAADYLLRAATATPGVLYVGVGDPDADHRCWERPEDMDTPRAVYSVSASSPGSDVAAETAAALAAASLALRAADPGYSRRLLAAARDVMAFAVRHQGKYSDHVGGDVGAYYASYSGYQDELLWGSAWLLWATRNASYLDYLASLGANDGVDMFSWDNKLAGARVLLSRRALVNGDRRLDAFRRLAEDFICRILPGSPSSTTQYTPGGMMYKSGHANLQYVTSASFLLTTFAKYMAVSNHTFSCQSLPVTAKTLRALARKQVDYILGANPQGMSYMVGYGARFPQRIHHRGASMPSVAAYPAHIGCQEGFSGYFNAGGANPNVHTGAVVGGPDQHDAFPDERGDYDRSEPTTYTNAALVGCLAYFAGSYRS | ||||||
Glycosylation | 264 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 368 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in roots and flowers.
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 471-473 | Cell attachment site | ||||
Sequence: RGD |
Sequence similarities
Belongs to the glycosyl hydrolase 9 (cellulase E) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length500
- Mass (Da)53,515
- Last updated2010-07-13 v3
- Checksum50775D45C78C1B02
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX548155 EMBL· GenBank· DDBJ | CAE01493.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008210 EMBL· GenBank· DDBJ | BAF14802.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014960 EMBL· GenBank· DDBJ | BAS89363.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000144 EMBL· GenBank· DDBJ | EAZ39589.1 EMBL· GenBank· DDBJ | Genomic DNA |