Q7XRI6 · Q7XRI6_ORYSJ
- ProteinRBR-type E3 ubiquitin transferase
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids589 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates.
Catalytic activity
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | ubiquitin-protein transferase activity | |
Molecular Function | zinc ion binding | |
Biological Process | protein ubiquitination |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRBR-type E3 ubiquitin transferase
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ7XRI6
- Secondary accessions
Proteomes
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-45 | Disordered | ||||
Sequence: MDSEDDMLDANDSADDDFYSGGEAGLGGSDDGDADYDFADHDSDD | ||||||
Domain | 130-343 | RING-type | ||||
Sequence: RELTCGICFENCPRTSMSAAACGHPFCSACWRGYISTSINDGPGCLMLRCPDPSCTAAVGQDMINSLADDEDREKYGRYLRRSYIEDNRKTKWCPAPGCEYAVEFVMGSGSYDVNCNCSYGFCWNCTEEAHRPVDCATVSKWILKNSAESENMNWILANSKPCPKCKRPIEKNQGCMHITCTPPCKFEFCWLCLGPWSEHGERTGGFYACNRYE | ||||||
Domain | 134-178 | RING-type | ||||
Sequence: CGICFENCPRTSMSAAACGHPFCSACWRGYISTSINDGPGCLMLR | ||||||
Region | 517-562 | Disordered | ||||
Sequence: GPSTSHGTCSKSATSKSLGSKSKSSKSRASSTSSKTGGSSRGVDES | ||||||
Domain | 561-589 | RanBP2-type | ||||
Sequence: ESNIWTCDQCTYANPRSARNCQACNNQHR |
Sequence similarities
Belongs to the RBR family. Ariadne subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length589
- Mass (Da)66,553
- Last updated2004-03-01 v2
- Checksum8C1A61F7EAF14DC7
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL662938 EMBL· GenBank· DDBJ | CAE02043.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL731617 EMBL· GenBank· DDBJ | CAE02496.2 EMBL· GenBank· DDBJ | Genomic DNA |