Q7XPE8 · NRX3_ORYSJ
- ProteinProbable nucleoredoxin 3
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids471 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.
Catalytic activity
- [protein]-dithiol + NAD+ = [protein]-disulfide + H+ + NADH
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | thioredoxin-disulfide reductase (NADPH) activity |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProbable nucleoredoxin 3
- EC number
- Short namesOsNrx3
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ7XPE8
- Secondary accessions
Proteomes
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000394852 | 1-471 | Probable nucleoredoxin 3 | |||
Sequence: MGETAEGVEAGEKYVSIPQLAGVGTLLSNGGKEIPLSSIEGKRICLFFSAHWCRPCRNFTPKLLQIYRKLRNTCKNMEIIFISLDRDEISFLDYFKGMPWLALPFDTGLRQKLCVQFDIEHIPALIPLSTTLSHGFRVEEDAVKLVEEYGVDAYPFGAKRRSELEGMDDARRQGGNLLQLLGCKEREYVISADGIKTPISDLNGKTIGLYFGAHWCPPCRAFTKQLREAYDELKALRPGNFQVIFISMDRNEEEFQASLSAMPWFAIPYSDTTVQELSRIFTIKGIPTLLILGPDGKVFKTDGRRIISKYGAMAFPFTESRAYELEEVLKKERDSLPHRVRDHRHEHELELDMAKAYLSTQLFHQTPSVQPCRLNLKTLREEYHLIFTNSNRKTSRPQSSYTRQQRDLNNLYSDPKHLPQLHKHFDQSNVATAENSLRFLNGEPENSDISSIHVAFADLAGKIRGEDDKRD |
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 15-173 | Thioredoxin 1 | ||||
Sequence: VSIPQLAGVGTLLSNGGKEIPLSSIEGKRICLFFSAHWCRPCRNFTPKLLQIYRKLRNTCKNMEIIFISLDRDEISFLDYFKGMPWLALPFDTGLRQKLCVQFDIEHIPALIPLSTTLSHGFRVEEDAVKLVEEYGVDAYPFGAKRRSELEGMDDARRQ | ||||||
Domain | 179-334 | Thioredoxin 2 | ||||
Sequence: QLLGCKEREYVISADGIKTPISDLNGKTIGLYFGAHWCPPCRAFTKQLREAYDELKALRPGNFQVIFISMDRNEEEFQASLSAMPWFAIPYSDTTVQELSRIFTIKGIPTLLILGPDGKVFKTDGRRIISKYGAMAFPFTESRAYELEEVLKKERD |
Sequence similarities
Belongs to the nucleoredoxin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length471
- Mass (Da)53,797
- Last updated2004-03-01 v2
- Checksum164990C84FFC5FAD
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0P0WEX0 | A0A0P0WEX0_ORYSJ | Os04g0608600 | 199 |
Sequence caution
Keywords
- Technical term