Q7XM13 · WOX1_ORYSJ
- ProteinWUSCHEL-related homeobox 1
- GeneWOX1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids289 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcription repressor required for the formation and development of tiller buds and panicles (PubMed:25697101).
Required for tiller formation and female sterility (PubMed:27194802).
Required for the early developmental stages of axillary meristem formation (PubMed:25841039).
Plays a role in maintaining the axillary premeristem zone and in promoting the formation of the axillary meristem by promoting OSH1 expression (PubMed:25841039).
Does not seem to be involved in maintenance of the shoot apical meristem (SAM) (PubMed:25841039).
Required for tiller formation and female sterility (PubMed:27194802).
Required for the early developmental stages of axillary meristem formation (PubMed:25841039).
Plays a role in maintaining the axillary premeristem zone and in promoting the formation of the axillary meristem by promoting OSH1 expression (PubMed:25841039).
Does not seem to be involved in maintenance of the shoot apical meristem (SAM) (PubMed:25841039).
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 31-96 | Homeobox; WUS-type | ||||
Sequence: PSGTRWTPTTEQIKILRELYYSCGIRSPNSEQIQRIAAMLRQYGRIEGKNVFYWFQNHKARERQKK |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor activity | |
Biological Process | axillary shoot meristem initiation | |
Biological Process | negative regulation of DNA-templated transcription | |
Biological Process | plant organ development |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameWUSCHEL-related homeobox 1
- Short namesOsWOX1
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ7XM13
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Disrupted formation of tiller buds, and female sterility (PubMed:25697101).
Defects in axillary bud formation, and partial defects in branching of the panicle (PubMed:25841039).
Defects in axillary bud formation, and partial defects in branching of the panicle (PubMed:25841039).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 79-85 | In srt1; defects in tiller formation and complete female sterility. | ||||
Sequence: Missing |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000308632 | 1-289 | WUSCHEL-related homeobox 1 | |||
Sequence: MDHMQQQQRQQVGGGGGEEVAGRGGVPVCRPSGTRWTPTTEQIKILRELYYSCGIRSPNSEQIQRIAAMLRQYGRIEGKNVFYWFQNHKARERQKKRLTTLDVTTTTAAAADADASHLAVLSLSPTAAGATAPSFPGFYVGNGGAVQTDQANVVNWDCTAMAAEKTFLQDYMGVSGVGCAAGAAPTPWAMTTTTREPETLPLFPVVFVGGDGAHRHAVHGGFPSNFQRWGSAAATSNTITVQQHLQQHNFYSSSSSQLHSQDGPAAGTSLELTLSSYYCSCSPYPAGSM |
Proteomic databases
Expression
Tissue specificity
Expressed in young leaf primordia. Expressed in branch an floral meristems. Transiently expressed in the shoot apex.
Induction
Induced by the cytokinin 6-benzylaminopurine.
Interaction
Subunit
Interacts with TPR1, TPR2 and TPR3.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q7XM13 | WOX3 Q33DK1 | 3 | EBI-1100547, EBI-1100563 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-34 | Disordered | ||||
Sequence: MDHMQQQQRQQVGGGGGEEVAGRGGVPVCRPSGT |
Sequence similarities
Belongs to the WUS homeobox family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length289
- Mass (Da)30,954
- Last updated2019-02-13 v3
- Checksum5952E631B589F301
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 177-182 | in Ref. 1; BAE48303 | ||||
Sequence: VGCAAG → GGGADA | ||||||
Sequence conflict | 206-208 | in Ref. 1; BAE48303 | ||||
Sequence: VFV → GGG | ||||||
Sequence conflict | 218 | in Ref. 1; BAE48303 | ||||
Sequence: V → G | ||||||
Sequence conflict | 236 | in Ref. 1; BAE48303 | ||||
Sequence: S → T | ||||||
Sequence conflict | 237 | in Ref. 2; CAJ84138 and 3; CAE04846 | ||||
Sequence: N → Y |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB218894 EMBL· GenBank· DDBJ | BAE48303.1 EMBL· GenBank· DDBJ | mRNA | ||
AM234746 EMBL· GenBank· DDBJ | CAJ84138.1 EMBL· GenBank· DDBJ | mRNA | ||
AL606999 EMBL· GenBank· DDBJ | CAE04846.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014960 EMBL· GenBank· DDBJ | BAS91481.1 EMBL· GenBank· DDBJ | Genomic DNA |