Q7XCL0 · EXLA2_ORYSJ
- ProteinExpansin-like A2
- GeneEXLA2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids275 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Biological Process | anatomical structure morphogenesis | |
Biological Process | plant-type cell wall loosening |
Names & Taxonomy
Protein names
- Recommended nameExpansin-like A2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ7XCL0
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-30 | |||||
Sequence: MAVRCCSSMASASVVLFFVVVGMSASMVSG | ||||||
Chain | PRO_0000252099 | 31-275 | Expansin-like A2 | |||
Sequence: CDRCVRRSKAGFRDSSIALNAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSRPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAWSTAQAPAGPLQFRVVVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQIADVAQEGCYPCDTQEWK | ||||||
Glycosylation | 113 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 158 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Induction
Down-regulated by gibberellin (GA3).
Developmental stage
Expressed in the growing regions of coleoptiles, internodes, and leaves.
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 51-156 | Expansin-like EG45 | ||||
Sequence: AGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAG | ||||||
Domain | 171-254 | Expansin-like CBD | ||||
Sequence: RELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAWSTAQAPAGPLQFRVVVTGGYDGKWVWADGEVLPRRWTAGRVYDA |
Sequence similarities
Belongs to the expansin family. Expansin-like A subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length275
- Mass (Da)29,301
- Last updated2003-10-01 v1
- ChecksumE088C7DF0596A1C7
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC051633 EMBL· GenBank· DDBJ | AAG13596.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DP000086 EMBL· GenBank· DDBJ | AAP54861.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008216 EMBL· GenBank· DDBJ | BAF27108.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014966 EMBL· GenBank· DDBJ | BAT11876.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK066611 EMBL· GenBank· DDBJ | BAG90052.1 EMBL· GenBank· DDBJ | mRNA | ||
AK068088 EMBL· GenBank· DDBJ | BAG90751.1 EMBL· GenBank· DDBJ | mRNA |