Q7X8D4 · SDC3_ORYSJ
- ProteinSerine decarboxylase 3
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids446 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Catalyzes the biosynthesis of ethanolamine from serine. Decarboxylation of free serine is the major source of ethanolamine production in plants and ethanolamine metabolism is crucial for the synthesis of choline, phosphatidylethanolamine (PE) and phosphatidylcholine (PC), and thus for plant growth (By similarity).
Catalytic activity
- H+ + L-serine = CO2 + ethanolamine
Cofactor
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 162 | substrate | ||||
Sequence: H |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | pyridoxal phosphate binding | |
Molecular Function | serine decarboxylase activity | |
Biological Process | carboxylic acid metabolic process |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSerine decarboxylase 3
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ7X8D4
Proteomes
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000429510 | 1-446 | Serine decarboxylase 3 | |||
Sequence: MATFKEHLQERSAHSIGRVNAHGYEDSNFLLTKLTENKMSCPMTISMLAPTLGTVGRINEESRTRRNAGYPINFEFDFGPVIEFLNMRLNNAGDPFMECNYGIHSKKFEIAVLDWFARLWELPKDQYWGYVTSGGTEGNMHGLLVGRELFPEGIIYTSCDSHYSIFKAAKMYRVQCIKIDTLFSGEMDYADFRRKLLQNTRSPAIVNVNIGTTMKGAVDDLDEVVMILENCGFANRFYIHCDSALVGLMMPFIKQAPKLTFKKPIGSICISGHKFIGCPIPCGVLITRLMDINHVMSTNIEYISSNDTTIAGSRNGHAPIFLWYALKRIGYNGLCKTVENCLKNAQYLALRLREMGVSVFLNALSITVVFERPNDETFVRKWQLACQGKIAHVVVMPNVSLERINMFLEEFTKSRIALHQDKCVAGDVSQENCLCSLHLDRKKEAV | ||||||
Modified residue | 274 | N6-(pyridoxal phosphate)lysine | ||||
Sequence: K |
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Sequence similarities
Belongs to the group II decarboxylase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length446
- Mass (Da)50,426
- Last updated2004-07-05 v2
- Checksum2F4E450A009C8316
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL731602 EMBL· GenBank· DDBJ | CAE05435.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL731612 EMBL· GenBank· DDBJ | CAE04954.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008210 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AP014960 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |