Q7WVY1 · Q7WVY1_COLP3
- ProteinAminopeptidase N
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids629 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
Catalytic activity
- Release of an N-terminal amino acid, Xaa-|-Yaa- from a peptide, amide or arylamide. Xaa is preferably Ala, but may be most amino acids including Pro (slow action). When a terminal hydrophobic residue is followed by a prolyl residue, the two may be released as an intact Xaa-Pro dipeptide.
Cofactor
Note: Binds 1 zinc ion per subunit.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 168-170 | a peptide (UniProtKB | ChEBI) | ||||
Sequence: QNQ | ||||||
Binding site | 295-300 | a peptide (UniProtKB | ChEBI) | ||||
Sequence: PFGGME | ||||||
Binding site | 300 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 324 | Zn2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: H | ||||||
Active site | 325 | Proton acceptor | ||||
Sequence: E | ||||||
Binding site | 328 | Zn2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: H | ||||||
Binding site | 328 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 347 | Zn2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: E | ||||||
Binding site | 347 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Active site | 410 | Proton donor | ||||
Sequence: Y | ||||||
Binding site | 584-586 | a peptide (UniProtKB | ChEBI) | ||||
Sequence: RRK |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | aminopeptidase activity | |
Molecular Function | metallopeptidase activity | |
Molecular Function | zinc ion binding | |
Biological Process | proteolysis |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameAminopeptidase N
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Alteromonadales > Colwelliaceae > Colwellia
Accessions
- Primary accessionQ7WVY1
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-24 | |||||
Sequence: MKHFSKLCFLLSTFAVSIAPVTWA | ||||||
Chain | PRO_5010683655 | 25-629 | Aminopeptidase N | |||
Sequence: HEGATHQHANVSKLTDAYTYANYDQVKATHVYLDLNVDFDKKSLSGFAELSLDWFTDNKAPLILDTRDLVIHRVMAKNSQGQWVKVNYDLAKRDDVLGSKLTINTPLNAKKVRVYYNSTEKATGLQWLSAEQTAGKEKPFLFSQNQAIHARSWIPIQDTPSVRVTYTARITTDKDLLAVMSANNEPGTERDGDYFFSMPQAIPPYLIAIGVGDLEFKAMSHQTGIYAESYILDAAVAEFDDTQAMIDKAEQMYGKYRWGRYDLLMLPPSFPFGGMENPRLSFITPTVVAGDKSLVNLIAHELAHSWSGNLVTNESWRDLWLNEGFTSYVENRIMEAVFGTDRAVMEQALGAQDLNAEILELDASDTQLYIDLKGRDPDDAFSGVPYVKGQLFLMYLEEKFGRERFDAFVLEYFDSHAFQSLGTDNFVKYLKANLTDKYPNIVSDNEINEWIFKAGLPSYAPQPTSNAFKVIDKQINQLVTDELTLEQLPTAQWTLHEWLHFINNLPVDLDHQRMVNLDKAFDLTNSSNAEIAHAWYLLSVRADYKEVYPAMAKYLKSIGRRKLIVPLYKELAKNAESKAWAVEVYKQARPGYHGLAQGTVDGVLK |
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 489-628 | Peptidase M1 leukotriene A4 hydrolase/aminopeptidase C-terminal | ||||
Sequence: SNAFKVIDKQINQLVTDELTLEQLPTAQWTLHEWLHFINNLPVDLDHQRMVNLDKAFDLTNSSNAEIAHAWYLLSVRADYKEVYPAMAKYLKSIGRRKLIVPLYKELAKNAESKAWAVEVYKQARPGYHGLAQGTVDGVL |
Sequence similarities
Belongs to the peptidase M1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusFragment
- Length629
- Mass (Da)71,274
- Last updated2003-10-01 v1
- ChecksumE252F5DDC169D1C5
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 629 | |||||
Sequence: K |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY302752 EMBL· GenBank· DDBJ | AAP94017.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP000083 EMBL· GenBank· DDBJ | AAZ24561.1 EMBL· GenBank· DDBJ | Genomic DNA |