Q7TP17 · U2AF4_RAT
- ProteinSplicing factor U2AF 26 kDa subunit
- GeneU2af1l4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids220 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
RNA-binding protein that function as a pre-mRNA splicing factor. Plays a critical role in both constitutive and enhancer-dependent splicing by mediating protein-protein interactions and protein-RNA interactions required for accurate 3'-splice site selection. Acts by enhancing the binding of U2AF2 to weak pyrimidine tracts. Also participates in the regulation of alternative pre-mRNA splicing. Activates exon 5 skipping of PTPRC during T-cell activation; an event reversed by GFI1. Binds to RNA at the AG dinucleotide at the 3'-splice site. Shows a preference for AGC or AGA.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nuclear speck | |
Cellular Component | spliceosomal complex | |
Cellular Component | U2AF complex | |
Molecular Function | metal ion binding | |
Molecular Function | pre-mRNA 3'-splice site binding | |
Biological Process | mRNA splicing, via spliceosome |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSplicing factor U2AF 26 kDa subunit
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionQ7TP17
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Interaction with C1QBP is required for the nuclear translocation. Displays active nucleo-cytoplasmic shuttling.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylalanine | ||||
Sequence: A | ||||||
Chain | PRO_0000309742 | 2-220 | Splicing factor U2AF 26 kDa subunit | |||
Sequence: AEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQTADGSHCHVSDVEVQEHYDNFFEEVFTELQEKYGEIEEMNVCDNLGDHLVGNVYVKFRREEDAERAVAELNNRWFNGQAVHAELSPVTDFRESCCRQYEMGECTRGGFCNFMHLRPISRNLRRQLYGRGPRHRSPPRSHTGHRPRERNRRRSPDHRHGRF |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Structure
Family & Domains
Features
Showing features for zinc finger, domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Zinc finger | 12-40 | C3H1-type 1 | ||||
Sequence: EKDKVNCSFYFKIGACRHGDRCSRLHNKP | ||||||
Domain | 65-147 | RRM | ||||
Sequence: SHCHVSDVEVQEHYDNFFEEVFTELQEKYGEIEEMNVCDNLGDHLVGNVYVKFRREEDAERAVAELNNRWFNGQAVHAELSPV | ||||||
Zinc finger | 149-176 | C3H1-type 2 | ||||
Sequence: DFRESCCRQYEMGECTRGGFCNFMHLRP | ||||||
Region | 186-220 | Disordered | ||||
Sequence: YGRGPRHRSPPRSHTGHRPRERNRRRSPDHRHGRF |
Domain
The second zinc finger in necessary for interaction with GFI1 and for alternative pre-mRNA splicing events.
The region 162-220 is essential for the nuclear import of the protein in spite of the absence of a nuclear localization signal (NLS). This region is essential for the interaction with C1QBP, interaction which is required for the nuclear translocation. This region may be involved in the localization in nuclear dot-like structures and it also confers the ability of nucleo-cytoplasmic shuttling.
Sequence similarities
Belongs to the splicing factor SR family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q7TP17-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length220
- Mass (Da)25,836
- Last updated2003-10-01 v1
- Checksum90AC4B4126060169
Q7TP17-2
- Name2
- Differences from canonical
- 1-43: MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFS → MVIQVVRTITQKRKPTAERQTSRKKNQGLTALFTLRLGPAGTGTGAPDFTTNRLSARVGYTLHAVPLSELRSLLNFV
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8I6A441 | A0A8I6A441_RAT | U2af1l4 | 188 | ||
A0A8I6A4P9 | A0A8I6A4P9_RAT | U2af1l4 | 187 | ||
A0A8I5ZTD8 | A0A8I5ZTD8_RAT | U2af1l4 | 181 |
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_029266 | 1-43 | in isoform 2 | |||
Sequence: MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFS → MVIQVVRTITQKRKPTAERQTSRKKNQGLTALFTLRLGPAGTGTGAPDFTTNRLSARVGYTLHAVPLSELRSLLNFV |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY325237 EMBL· GenBank· DDBJ | AAP92638.1 EMBL· GenBank· DDBJ | mRNA | ||
AY325238 EMBL· GenBank· DDBJ | AAP92639.1 EMBL· GenBank· DDBJ | mRNA |