Q7T1E0 · Q7T1E0_DANRE
- ProteinGlycerol-3-phosphate dehydrogenase [NAD(+)]
- Genegpd1b
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids350 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Has glycerol-3-phosphate dehydrogenase activity.
Catalytic activity
- NAD+ + sn-glycerol 3-phosphate = dihydroxyacetone phosphate + H+ + NADHThis reaction proceeds in the forward direction.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 10-15 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: GSGNWG | ||||||
Binding site | 41 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: F | ||||||
Binding site | 97 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: F | ||||||
Binding site | 120 | substrate | ||||
Sequence: K | ||||||
Binding site | 153 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: A | ||||||
Active site | 204 | Proton acceptor | ||||
Sequence: K | ||||||
Binding site | 270 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 270-271 | substrate | ||||
Sequence: RN | ||||||
Binding site | 297 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 299 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: Q |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | glycerol-3-phosphate dehydrogenase (FAD) complex | |
Molecular Function | glycerol-3-phosphate dehydrogenase (NAD+) activity | |
Molecular Function | NAD binding | |
Molecular Function | protein homodimerization activity | |
Biological Process | carbohydrate metabolic process | |
Biological Process | glycerol-3-phosphate catabolic process | |
Biological Process | glycerol-3-phosphate metabolic process | |
Biological Process | NADH oxidation |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGlycerol-3-phosphate dehydrogenase [NAD(+)]
- EC number
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionQ7T1E0
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Interaction
Subunit
Homodimer.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 5-171 | Glycerol-3-phosphate dehydrogenase NAD-dependent N-terminal | ||||
Sequence: KICIIGSGNWGSAIAKIVGANAAKYNTFENTVNMWVFEEMINGRKLTEIINTEHENVKYLPGHKLPPNVLAVPDLLESVKGADILIFVIPHQFVSRICDTIKGHIKPDAVGMSLIKGVDEGPDGLKLISDVIREKLGITMTVLMGANLANEVADEKFCETTIGCKSK | ||||||
Domain | 197-340 | Glycerol-3-phosphate dehydrogenase NAD-dependent C-terminal | ||||
Sequence: VEICGALKNIVAVGAGFCDGLSFGDNTKAAVIRLGLMEMIAFARLFCTASPVSPATFLESCGVADLITTCYGGRNRKVGEAFARTGKSIEELEKEMLNGQKLQGPATAAEVHQILKHKNLVEKFPLFNAVYQICFQNHPVKEFI |
Sequence similarities
Belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length350
- Mass (Da)38,194
- Last updated2003-10-01 v1
- Checksum6A124D0095BFFCD5
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC055382 EMBL· GenBank· DDBJ | AAH55382.1 EMBL· GenBank· DDBJ | mRNA | ||
BC067596 EMBL· GenBank· DDBJ | AAH67596.1 EMBL· GenBank· DDBJ | mRNA | ||
DQ677583 EMBL· GenBank· DDBJ | ABG78033.1 EMBL· GenBank· DDBJ | mRNA |