Q7SYB2 · THOC1_DANRE
- ProteinTHO complex subunit 1
- Genethoc1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids655 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and which specifically associates with spliced mRNA and not with unspliced pre-mRNA (By similarity).
Required for efficient export of polyadenylated RNA (By similarity).
The THOC1-THOC2-THOC3 core complex alone is sufficient to bind export factor NXF1-NXT1 and promote ATPase activity of DDX39B (By similarity).
TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NXF1 pathway (By similarity).
Regulates transcriptional elongation of a subset of genes (By similarity).
Involved in genome stability by preventing co-transcriptional R-loop formation (By similarity).
May play a role in hair cell formation, hence may be involved in hearing (PubMed:32776944).
Required for efficient export of polyadenylated RNA (By similarity).
The THOC1-THOC2-THOC3 core complex alone is sufficient to bind export factor NXF1-NXT1 and promote ATPase activity of DDX39B (By similarity).
TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NXF1 pathway (By similarity).
Regulates transcriptional elongation of a subset of genes (By similarity).
Involved in genome stability by preventing co-transcriptional R-loop formation (By similarity).
May play a role in hair cell formation, hence may be involved in hearing (PubMed:32776944).
Participates in an apoptotic pathway which is characterized by activation of caspase-6, increases in the expression of BAK1 and BCL2L1 and activation of NF-kappa-B. This pathway does not require p53/TP53, nor does the presence of p53/TP53 affect the efficiency of cell killing. Activates a G2/M cell cycle checkpoint prior to the onset of apoptosis. Apoptosis is inhibited by association with RB1. Essential for early embryonic development. Required for normal gene expression during postnatal testis development.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | nuclear matrix | |
Cellular Component | nucleoplasm | |
Cellular Component | THO complex part of transcription export complex | |
Molecular Function | DNA binding | |
Molecular Function | RNA binding | |
Biological Process | apoptotic process | |
Biological Process | mRNA export from nucleus | |
Biological Process | mRNA processing | |
Biological Process | regulation of apoptotic process | |
Biological Process | RNA splicing | |
Biological Process | signal transduction |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameTHO complex subunit 1
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionQ7SYB2
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Predominantly localized in the nucleus. Shuttles between the nucleus and cytosol. Nuclear localization is required for induction of apoptotic cell death. Translocates to the cytoplasm during the early phase of apoptosis execution.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Knockdown animals exhibit an impaired startle response, suggesting hearing dysfunction. They show greatly reduced hair cell numbers.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000458470 | 1-655 | THO complex subunit 1 | |||
Sequence: MSPPSHFDFIEARDKFTVATKNAVDTRNCKPLTTAFSHLPGNETEKKATLDQALRGVLEEQIVNQKVNVDDFLSLIYISIDGVTEGICSATTPFLLLGDVLDCLPLDQCDKIFSFVEENVSTWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLDNITVFNKNEQDSTLGQQHTEVKEEGMDVEEGEMGDEDAPAPSSIPIDYNLYRKFWTLQDYFRNPVQCYDKFSWMTFIKYSDEALAVFKSFKLDDMQASKKKLEEMRTSSGDHVYFAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSSCVLNDDQSLWIEDTTKLVYQLLKEIPPDGDKFGSMVEHILNTEENWNSWKNEGCPSFVKERPAETKPIRPSRKRQAPEDFLGKGPDRKILMGNDELTRLWNLNPDNMEACKSENREFMPSLEDFFEEAIEQADPANMVEDEYKVVRNSNYGWRALRLLSRRSPHFFQPTNQQFKSLADYLENMVIKLAKELPKDIPSEEIKTGEEDDDENGDNLLKDSNDSPSIQSKAVTNSQMDEIAAKLGSQWKTLADHLEMSDKEIRVIESDSEDVDLQAKMLLVAWQDREGSQATMESLVTALNAAGFNNIADNLSET |
Expression
Tissue specificity
Expressed in the developing neuromast.
Interaction
Subunit
Component of the THO complex.
Structure
Family & Domains
Features
Showing features for region, motif, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 403-427 | Disordered | ||||
Sequence: ERPAETKPIRPSRKRQAPEDFLGKG | ||||||
Motif | 415-431 | Nuclear localization signal | ||||
Sequence: RKRQAPEDFLGKGPDRK | ||||||
Region | 539-574 | Disordered | ||||
Sequence: PSEEIKTGEEDDDENGDNLLKDSNDSPSIQSKAVTN | ||||||
Compositional bias | 559-574 | Polar residues | ||||
Sequence: KDSNDSPSIQSKAVTN | ||||||
Domain | 573-655 | Death | ||||
Sequence: TNSQMDEIAAKLGSQWKTLADHLEMSDKEIRVIESDSEDVDLQAKMLLVAWQDREGSQATMESLVTALNAAGFNNIADNLSET |
Domain
An intact death domain is needed for apoptosis.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length655
- Mass (Da)74,998
- Last updated2003-10-01 v1
- Checksum3E0E92260D81C7E9
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 559-574 | Polar residues | ||||
Sequence: KDSNDSPSIQSKAVTN |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC054938 EMBL· GenBank· DDBJ | AAH54938.1 EMBL· GenBank· DDBJ | mRNA | ||
CABZ01057209 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CABZ01057210 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |