Q7SXY4 · DC2L1_DANRE
- ProteinCytoplasmic dynein 2 light intermediate chain 1
- Genedync2li1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids358 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 2 complex (dynein-2 complex), a motor protein complex that drives the movement of cargos along microtubules within cilia and flagella in concert with the intraflagellar transport (IFT) system, facilitating the assembly of these organelles.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | axoneme | |
Cellular Component | centrosome | |
Cellular Component | ciliary basal body | |
Cellular Component | cytoplasmic dynein complex | |
Cellular Component | microtubule | |
Cellular Component | non-motile cilium | |
Molecular Function | dynein heavy chain binding | |
Biological Process | intraciliary retrograde transport | |
Biological Process | intraciliary transport | |
Biological Process | intraciliary transport involved in cilium assembly |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameCytoplasmic dynein 2 light intermediate chain 1
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionQ7SXY4
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes to the apical cytoplasm.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000318753 | 1-358 | Cytoplasmic dynein 2 light intermediate chain 1 | |||
Sequence: MPKVSSDTLWDIAAAEVRSRESRTDEEEAEEEDAHFPSQRTVFFMGSKAGGKTTILLRFLERDETAKPTLALEYTFGRRARGHNTPKDIAHLWELGGGISLSDLVQIPITADNVSFLSVVLVLDLSKPNALWETMESLLGSARNQVEKVCAALQKTGESRSGKQRVPRVLHKDYPDRELISPFPVPLLIVGSKFDIFQDFDSEKRKVICKTLRFLAHFYGASLIFTSSKSETTMSKSRSFINQLAFGTERPKSISTDPSKPLAIPAGSDSLSQIGPPVATEVDIGTLHAKNPFDLWKKVFEKVFPHESTRERKELKDPVKDPQFSEPLIDSIRAQKDQELDQYKREQAKSWKSLALDP |
Proteomic databases
Interaction
Subunit
Light intermediate chain of the cytoplasmic dynein complex 2, a multisubunit complex composed at least of eleven different proteins. The cytoplasmic dynein 2 complex consists of two catalytic heavy chains (HCs) and a number of non-catalytic subunits presented by intermediate chains (ICs), light intermediate chains (LICs) and light chains (LCs). Among them, a heavy chain (DYNC2H1), two intermediate chains (DYNC2I2 and DYNC2I1), a light intermediate chain (DYNC2LI1), and a light chain (DYNLT2B) are unique to the dynein-2 complex, but a subset of light chains are also shared by dynein-1 and dynein-2 complexes. Dynein-2 complex is built around two copies of cytoplasmic dynein 2 heavy chain 1 (DYNC2H1). The C-terminal region forms the motor domain, which converts the energy from ATP hydrolysis into movement. Its N-terminal region forms the tail, an extended structure that binds the other subunits and holds the two heavy chains in a homodimer.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-35 | Disordered | ||||
Sequence: MPKVSSDTLWDIAAAEVRSRESRTDEEEAEEEDAH | ||||||
Compositional bias | 307-323 | Basic and acidic residues | ||||
Sequence: ESTRERKELKDPVKDPQ | ||||||
Region | 307-358 | Disordered | ||||
Sequence: ESTRERKELKDPVKDPQFSEPLIDSIRAQKDQELDQYKREQAKSWKSLALDP | ||||||
Compositional bias | 332-352 | Basic and acidic residues | ||||
Sequence: IRAQKDQELDQYKREQAKSWK |
Sequence similarities
Belongs to the dynein light intermediate chain family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length358
- Mass (Da)40,189
- Last updated2003-10-01 v1
- Checksum01769370C1B7F5AD
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 307-323 | Basic and acidic residues | ||||
Sequence: ESTRERKELKDPVKDPQ | ||||||
Compositional bias | 332-352 | Basic and acidic residues | ||||
Sequence: IRAQKDQELDQYKREQAKSWK |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC055198 EMBL· GenBank· DDBJ | AAH55198.1 EMBL· GenBank· DDBJ | mRNA |