Q7SXM7 · PRP31_DANRE
- ProteinU4/U6 small nuclear ribonucleoprotein Prp31
- Geneprpf31
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids508 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Involved in pre-mRNA splicing as component of the spliceosome. Required for the assembly of the U4/U5/U6 tri-snRNP complex, one of the building blocks of the spliceosome.
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 258 | Interaction with U4 snRNA | ||||
Sequence: C | ||||||
Site | 281 | Interaction with U4 snRNA and U4atac snRNA | ||||
Sequence: H | ||||||
Site | 300 | Interaction with U4atac snRNA | ||||
Sequence: R | ||||||
Site | 304 | Interaction with U4 snRNA and U4atac snRNA | ||||
Sequence: R | ||||||
Site | 309 | Interaction with U4 snRNA and U4atac snRNA | ||||
Sequence: K |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | Cajal body | |
Cellular Component | MLL1 complex | |
Cellular Component | nuclear speck | |
Cellular Component | nucleus | |
Cellular Component | precatalytic spliceosome | |
Cellular Component | spliceosomal tri-snRNP complex | |
Cellular Component | U2-type precatalytic spliceosome | |
Cellular Component | U4 snRNP | |
Cellular Component | U4/U6 x U5 tri-snRNP complex | |
Cellular Component | U4atac snRNP | |
Molecular Function | U4atac snRNA binding | |
Biological Process | mRNA splicing, via spliceosome | |
Biological Process | regulation of alternative mRNA splicing, via spliceosome | |
Biological Process | retina development in camera-type eye | |
Biological Process | spliceosomal tri-snRNP complex assembly |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameU4/U6 small nuclear ribonucleoprotein Prp31
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionQ7SXM7
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Predominantly found in speckles and in Cajal bodies.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000227801 | 1-508 | U4/U6 small nuclear ribonucleoprotein Prp31 | |||
Sequence: MSLADELLADLEEAGEEDGLYPGGEEGESDGEPGERQVDGGLEDIPEEMEVDYSSTESVTSIAKLRHSKPFAEIMDKISHYVGNQRKNSEVSGPVEADPEYRLIVAANNLTVEIDNELNIIHKFVRDKYSKRFPELESLVPNALDYIRTVKELGNNLEKCKNNETLQQILTNATIMVVSVTASTTQGTMLGDDELQRLEEACDMALELNQSKHRIYEYVESRMSFIAPNLSIIVGASTAAKIMGVAGGLTNLSKMPACNLMLLGAQRRTLSGFSSTSLLPHTGYIYHCDVVQTLPPDLRRKAARLVSAKCTLASRVDSFHESADGKVGYDLKEEIERKFDKWQEPPPVKQVKPLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKHANRMTFAEIEDDAYQEDLGFSLGQLGKSGSGRVRQAQVNDSTKARISKSLQRTLQKQSMTYGGKSTVRDRSSGTSSSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSNMAEFLKVKREKEDKV |
Proteomic databases
Expression
Gene expression databases
Interaction
Subunit
Identified in the spliceosome B complex. Component of the U4/U6-U5 tri-snRNP complex. Component of some MLL1/MLL complex.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, coiled coil, domain, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-45 | Disordered | ||||
Sequence: MSLADELLADLEEAGEEDGLYPGGEEGESDGEPGERQVDGGLEDI | ||||||
Compositional bias | 9-25 | Acidic residues | ||||
Sequence: ADLEEAGEEDGLYPGGE | ||||||
Compositional bias | 29-43 | Basic and acidic residues | ||||
Sequence: SDGEPGERQVDGGLE | ||||||
Coiled coil | 96-131 | |||||
Sequence: EADPEYRLIVAANNLTVEIDNELNIIHKFVRDKYSK | ||||||
Coiled coil | 192-226 | |||||
Sequence: DDELQRLEEACDMALELNQSKHRIYEYVESRMSFI | ||||||
Domain | 226-344 | Nop | ||||
Sequence: IAPNLSIIVGASTAAKIMGVAGGLTNLSKMPACNLMLLGAQRRTLSGFSSTSLLPHTGYIYHCDVVQTLPPDLRRKAARLVSAKCTLASRVDSFHESADGKVGYDLKEEIERKFDKWQE | ||||||
Region | 345-368 | Disordered | ||||
Sequence: PPPVKQVKPLPAPLDGQRKKRGGR | ||||||
Motif | 362-375 | Nuclear localization signal (NLS) | ||||
Sequence: RKKRGGRRYRKMKE | ||||||
Region | 442-461 | Disordered | ||||
Sequence: QSMTYGGKSTVRDRSSGTSS |
Domain
Interacts with the snRNP via the Nop domain.
The coiled coil domain is formed by two non-contiguous helices.
Sequence similarities
Belongs to the PRP31 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length508
- Mass (Da)56,474
- Last updated2003-10-01 v1
- Checksum2CB8CFF09606DE5F
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 9-25 | Acidic residues | ||||
Sequence: ADLEEAGEEDGLYPGGE | ||||||
Compositional bias | 29-43 | Basic and acidic residues | ||||
Sequence: SDGEPGERQVDGGLE |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC055531 EMBL· GenBank· DDBJ | AAH55531.1 EMBL· GenBank· DDBJ | mRNA |