Q7SXL3 · TBP_DANRE
- ProteinTATA-box-binding protein
- Genetbp
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids302 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
General transcription factor that functions at the core of the DNA-binding multiprotein factor TFIID. Binding of TFIID to the TATA box is the initial transcriptional step of the pre-initiation complex (PIC), playing a role in the activation of eukaryotic genes transcribed by RNA polymerase II (By similarity).
Members of the TBP family are differentially required for transcription and development during early embryogenesis. Regulates mRNA levels in the early embryo by both transcriptional and post-transcriptional mechanisms. Required for transcription of a subset of genes at the mid-blastula transition (MBT). Negatively regulates the expression of other embryonic genes, including autoregulation of the tbp promoter itself. Also functions within a transcription-dependent mechanism to direct the temporally-regulated degradation of a subset of maternal mRNAs after the MBT. This is part of a general mechanism to regulate the maternal to zygotic transition and is required for normal embryonic development. Binds to promoters of a subset of genes. Required for gastrulation
Members of the TBP family are differentially required for transcription and development during early embryogenesis. Regulates mRNA levels in the early embryo by both transcriptional and post-transcriptional mechanisms. Required for transcription of a subset of genes at the mid-blastula transition (MBT). Negatively regulates the expression of other embryonic genes, including autoregulation of the tbp promoter itself. Also functions within a transcription-dependent mechanism to direct the temporally-regulated degradation of a subset of maternal mRNAs after the MBT. This is part of a general mechanism to regulate the maternal to zygotic transition and is required for normal embryonic development. Binds to promoters of a subset of genes. Required for gastrulation
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Cellular Component | transcription factor TFIID complex | |
Molecular Function | DNA binding | |
Molecular Function | RNA polymerase II general transcription initiation factor activity | |
Molecular Function | RNA polymerase III general transcription initiation factor activity | |
Biological Process | DNA-templated transcription initiation | |
Biological Process | gastrulation | |
Biological Process | mRNA catabolic process | |
Biological Process | transcription by RNA polymerase II | |
Biological Process | transcription by RNA polymerase III |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTATA-box-binding protein
- Short nameszTBP
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionQ7SXL3
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000348608 | 1-302 | TATA-box-binding protein | |||
Sequence: MEQNNSLPPFAQGLASPQGAMTPGLPIFSPMMPYGTGLTPQPVQNSNSLSLLEEQQRQQQQQQAASQQQGGMVGGSGQTPQLYHSTQAVSTTTALPGNTPLYTTPLTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRGEIYEAFENIYPILKGFRKTS |
Proteomic databases
Expression
Tissue specificity
Enriched in testis but hardly detectable in the ovary (at protein level).
Developmental stage
Expressed both maternally and zygotically. Expression is very low in the zygote, increasing from morula stage onward to reach a peak during early gastrulation. Levels then rapidly decline during neurula and organogenesis stages (at protein level). There is an inverse correlation between mRNA and protein levels at the late blastula and early gastrula stages.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-22 | Disordered | ||||
Sequence: MEQNNSLPPFAQGLASPQGAMT | ||||||
Region | 50-81 | Disordered | ||||
Sequence: SLLEEQQRQQQQQQAASQQQGGMVGGSGQTPQ | ||||||
Repeat | 128-204 | 1 | ||||
Sequence: LQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVV | ||||||
Repeat | 218-295 | 2 | ||||
Sequence: IQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRGEIYEAFENIYPIL |
Sequence similarities
Belongs to the TBP family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length302
- Mass (Da)33,019
- Last updated2003-10-01 v1
- ChecksumC63A6C1D2F7E1D50
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 184 | in Ref. 2; AAQ07596 | ||||
Sequence: C → G |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY168633 EMBL· GenBank· DDBJ | AAO34524.1 EMBL· GenBank· DDBJ | mRNA | ||
AF503449 EMBL· GenBank· DDBJ | AAQ07596.1 EMBL· GenBank· DDBJ | mRNA | ||
AL772388 EMBL· GenBank· DDBJ | CAK04406.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC055549 EMBL· GenBank· DDBJ | AAH55549.1 EMBL· GenBank· DDBJ | mRNA | ||
BC065860 EMBL· GenBank· DDBJ | AAH65860.1 EMBL· GenBank· DDBJ | mRNA |