Q7JXF5 · NUP62_DROME
- ProteinNuclear pore glycoprotein p62
- GeneNup62
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids394 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Essential component of the nuclear pore complex (By similarity).
The N-terminal is probably involved in nucleocytoplasmic transport (By similarity).
The C-terminal is involved in protein-protein interaction probably via coiled-coil formation, promotes its association with centrosomes and may function in anchorage of Nup62 to the pore complex (By similarity).
Binds to transcriptionally active genes (PubMed:20144760).
Negatively regulates chromatin attachment to the nuclear envelope, probably by preventing chromatin tethering by Nup154 (PubMed:26341556).
The N-terminal is probably involved in nucleocytoplasmic transport (By similarity).
The C-terminal is involved in protein-protein interaction probably via coiled-coil formation, promotes its association with centrosomes and may function in anchorage of Nup62 to the pore complex (By similarity).
Binds to transcriptionally active genes (PubMed:20144760).
Negatively regulates chromatin attachment to the nuclear envelope, probably by preventing chromatin tethering by Nup154 (PubMed:26341556).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | centrosome | |
Cellular Component | chromatin | |
Cellular Component | cytoplasm | |
Cellular Component | nuclear envelope | |
Cellular Component | nuclear pore central transport channel | |
Cellular Component | spindle pole | |
Molecular Function | chromatin DNA binding | |
Molecular Function | phospholipid binding | |
Molecular Function | structural constituent of nuclear pore | |
Biological Process | chromosome attachment to the nuclear envelope | |
Biological Process | mRNA transport | |
Biological Process | oocyte karyosome formation | |
Biological Process | protein import into nucleus | |
Biological Process | regulation of nucleus size | |
Biological Process | RNA export from nucleus |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNuclear pore glycoprotein p62
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ7JXF5
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Central region of the nuclear pore, within the transporter (By similarity).
Associates with chromatin (PubMed:20144760).
Associates with chromatin (PubMed:20144760).
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown in oocytes results in increased nuclear size. RNAi-mediated knockdown in oocytes and nurse cells results in irregular distribution of chromatin to the nuclear periphery disrupting karyosome morphology. Simultaneous RNAi-mediated knockdown of nucleoporin Nup154 restores normal karyosome formation.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000439767 | 1-394 | Nuclear pore glycoprotein p62 | |||
Sequence: MVFQLPTTTAAPTGGATSSFSFGLSTGTPAAAPASGAATTAPATKTTFSFGTPAPTAGIGGGDADNSKAQAPPAFGFGLGSGTASAPLTLGTQAAANPASTTSATATGTSAAPPAFGGFTAQPAASVVPTIATSAPNTAATTTGLLGGSGLGAPKTTAAASTTLTAAPSAIASTQGAAPAPTLSTGGAFANLTTETKTTDSSAVSTASQLSYHQLEEHINKWTLEFEEQEKVFTEQATQINAWDKLLISNNGKIVELNDAVKKVKTDQQVLDQELEFIATQQKELEDSLGPLEKEFVNLPRVDMERSQTYLMVENLDTQLKQMSEDLKEIIDNLNEANKGQDTTDPIIQIGKILNAHMNSLQWIESQSTNISKKLEDIGKIQDSQKRDIFRAPF |
Proteomic databases
Expression
Tissue specificity
Expressed in adult male accessory glands (at protein level).
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for repeat, region, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 22-23 | 1 | ||||
Sequence: FG | ||||||
Region | 22-117 | 5 X 2 AA repeats of F-G | ||||
Sequence: FGLSTGTPAAAPASGAATTAPATKTTFSFGTPAPTAGIGGGDADNSKAQAPPAFGFGLGSGTASAPLTLGTQAAANPASTTSATATGTSAAPPAFG | ||||||
Region | 44-73 | Disordered | ||||
Sequence: TKTTFSFGTPAPTAGIGGGDADNSKAQAPP | ||||||
Repeat | 50-51 | 2 | ||||
Sequence: FG | ||||||
Repeat | 75-76 | 3 | ||||
Sequence: FG | ||||||
Repeat | 77-78 | 4 | ||||
Sequence: FG | ||||||
Repeat | 116-117 | 5 | ||||
Sequence: FG | ||||||
Coiled coil | 211-341 | |||||
Sequence: SYHQLEEHINKWTLEFEEQEKVFTEQATQINAWDKLLISNNGKIVELNDAVKKVKTDQQVLDQELEFIATQQKELEDSLGPLEKEFVNLPRVDMERSQTYLMVENLDTQLKQMSEDLKEIIDNLNEANKGQ |
Domain
Contains FG repeats. FG repeats are interaction sites for karyopherins (importins, exportins) and form probably an affinity gradient, guiding the transport proteins unidirectionally with their cargo through the NPC. FG repeat regions are highly flexible and lack ordered secondary structure. The overall conservation of FG repeats regarding exact sequence, spacing, and repeat unit length is limited.
Sequence similarities
Belongs to the nucleoporin NSP1/NUP62 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length394
- Mass (Da)40,684
- Last updated2006-10-03 v1
- Checksum6D3C1E3A149ECCE6
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE013599 EMBL· GenBank· DDBJ | AAF58007.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE013599 EMBL· GenBank· DDBJ | AHN56285.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY094707 EMBL· GenBank· DDBJ | AAM11060.1 EMBL· GenBank· DDBJ | mRNA |