Q7F2L3 · NAC48_ORYSJ
- ProteinNAC domain-containing protein 48
- GeneNAC048
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids303 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses (PubMed:20632034).
Transcription activator involved in response to abiotic and biotic stresses. Involved in drought and salt stress responses, and defense response to the rice blast fungus (PubMed:17587305).
Transcription activator involved tolerance to cold and salt stresses (PubMed:18273684).
Transcription activator involved in tolerance to drought stress. Targets directly and activates genes involved in membrane modification, nicotianamine (NA) biosynthesis, glutathione relocation, accumulation of phosphoadenosine phosphosulfate and glycosylation in roots (PubMed:27892643).
Controls root growth at early vegetative stage through chromatin modification and histone lysine deacytaltion by HDAC1 (PubMed:19453457).
Transcription activator involved in response to abiotic and biotic stresses. Involved in drought and salt stress responses, and defense response to the rice blast fungus (PubMed:17587305).
Transcription activator involved tolerance to cold and salt stresses (PubMed:18273684).
Transcription activator involved in tolerance to drought stress. Targets directly and activates genes involved in membrane modification, nicotianamine (NA) biosynthesis, glutathione relocation, accumulation of phosphoadenosine phosphosulfate and glycosylation in roots (PubMed:27892643).
Controls root growth at early vegetative stage through chromatin modification and histone lysine deacytaltion by HDAC1 (PubMed:19453457).
Miscellaneous
Plants overexpressing NAC048 exhibit growth retardation (PubMed:17587305, PubMed:20632034).
Plants overexpressing NAC048 exhibit improved tolerance to drought stress (PubMed:17587305, PubMed:27892643).
Plants overexpressing NAC048 show increased tolerance to salt stress (PubMed:17587305, PubMed:18273684).
Plants overexpressing NAC048 exhibit increased tolerance to cold stress (PubMed:18273684).
Plants overexpressing NAC048 show increased resistance to rice blast fungus (PubMed:17587305).
Plants overexpressing NAC048 exhibit improved tolerance to drought stress (PubMed:17587305, PubMed:27892643).
Plants overexpressing NAC048 show increased tolerance to salt stress (PubMed:17587305, PubMed:18273684).
Plants overexpressing NAC048 exhibit increased tolerance to cold stress (PubMed:18273684).
Plants overexpressing NAC048 show increased resistance to rice blast fungus (PubMed:17587305).
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | sequence-specific DNA binding | |
Biological Process | positive regulation of DNA-templated transcription | |
Biological Process | positive regulation of response to salt stress | |
Biological Process | positive regulation of response to water deprivation | |
Biological Process | regulation of defense response to fungus | |
Biological Process | response to cold | |
Biological Process | root development |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameNAC domain-containing protein 48
- Short namesONAC048
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ7F2L3
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Increased root length in young seedlings.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000132317 | 1-303 | NAC domain-containing protein 48 | |||
Sequence: MSGGQDLQLPPGFRFHPTDEELVMHYLCRRCAGLPIAVPIIAEIDLYKFDPWQLPRMALYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVGSPKPVAIKKALVFYAGKAPKGEKTNWIMHEYRLADVDRSARKKNSLRLDDWVLCRIYNKKGGLEKPPAAAVAAAGMVSSGGGVQRKPMVGVNAAVSSPPEQKPVVAGPAFPDLAAYYDRPSDSMPRLHADSSCSEQVLSPEFACEVQSQPKISEWERTFATVGPINPAASILDPAGSGGLGGLGGGGSDPLLQDILMYWGKPF |
Proteomic databases
PTM databases
Expression
Tissue specificity
Widely expressed.
Induction
Interaction
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 9-159 | NAC | ||||
Sequence: LPPGFRFHPTDEELVMHYLCRRCAGLPIAVPIIAEIDLYKFDPWQLPRMALYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVGSPKPVAIKKALVFYAGKAPKGEKTNWIMHEYRLADVDRSARKKNSLRLDDWVLCRIYNK |
Domain
The NAC domain includes a DNA binding domain and a dimerization domain.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length303
- Mass (Da)32,907
- Last updated2004-07-05 v1
- ChecksumE9E1ACBE29D54D1E
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 288 | in Ref. 8; EAZ14398 | ||||
Sequence: S → R | ||||||
Sequence conflict | 294 | in Ref. 8; EAZ14398 | ||||
Sequence: D → E |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB028185 EMBL· GenBank· DDBJ | BAA89800.1 EMBL· GenBank· DDBJ | mRNA | ||
AF254558 EMBL· GenBank· DDBJ | AAK17067.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
EU846993 EMBL· GenBank· DDBJ | ACJ54897.1 EMBL· GenBank· DDBJ | mRNA | ||
AP003561 EMBL· GenBank· DDBJ | BAB90381.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008207 EMBL· GenBank· DDBJ | BAF06930.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014957 EMBL· GenBank· DDBJ | BAS75586.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000138 EMBL· GenBank· DDBJ | EAZ14398.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK068392 EMBL· GenBank· DDBJ | BAG90892.1 EMBL· GenBank· DDBJ | mRNA |