Q7CQN4 · LPP1_SALTY
- ProteinMajor outer membrane lipoprotein Lpp 1
- Genelpp1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Plays an important role in virulence (PubMed:15213144).
A highly abundant outer membrane lipoprotein that controls the distance between the inner and outer membranes. The only protein known to be covalently linked to the peptidoglycan network (PGN). Also non-covalently binds the PGN. The link between the cell outer membrane and PGN contributes to maintenance of the structural and functional integrity of the cell envelope, and maintains the correct distance between the PGN and the outer membrane (By similarity).
A highly abundant outer membrane lipoprotein that controls the distance between the inner and outer membranes. The only protein known to be covalently linked to the peptidoglycan network (PGN). Also non-covalently binds the PGN. The link between the cell outer membrane and PGN contributes to maintenance of the structural and functional integrity of the cell envelope, and maintains the correct distance between the PGN and the outer membrane (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell outer membrane | |
Cellular Component | extracellular region | |
Molecular Function | lipid binding | |
Molecular Function | peptidoglycan binding | |
Biological Process | lipid modification | |
Biological Process | periplasmic space organization |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameMajor outer membrane lipoprotein Lpp 1
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Salmonella
Accessions
- Primary accessionQ7CQN4
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Cell outer membrane ; Lipid-anchor
Secreted, cell wall ; Peptidoglycan-anchor
Note: Attached via its lipidated N-terminus to the inner leaflet of the outer membrane. Attached to the peptidoglycan network (PGN) via its C-terminus.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
The integrity of the cell envelope in a lpp null mutant (double-knockout) is not affected.
PTM/Processing
Features
Showing features for signal, lipidation, chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-20 | |||||
Sequence: MNRTKLVLGAVILGSTLLAG | ||||||
Lipidation | 21 | N-palmitoyl cysteine | ||||
Sequence: C | ||||||
Lipidation | 21 | S-diacylglycerol cysteine | ||||
Sequence: C | ||||||
Chain | PRO_0000018344 | 21-78 | Major outer membrane lipoprotein Lpp 1 | |||
Sequence: CSSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNQATKYRK | ||||||
Modified residue | 78 | N6-murein peptidoglycan lysine | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
Expression
Induction
This gene is probably the major expressed form.
Interaction
Structure
Family & Domains
Features
Showing features for repeat, coiled coil, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 24-34 | |||||
Sequence: NAKIDQLSSDV | ||||||
Coiled coil | 27-75 | |||||
Sequence: IDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNQATK | ||||||
Repeat | 38-48 | |||||
Sequence: NAKVDQLSNDV | ||||||
Region | 56-78 | Disordered | ||||
Sequence: QAAKDDAARANQRLDNQATKYRK | ||||||
Compositional bias | 57-78 | Basic and acidic residues | ||||
Sequence: AAKDDAARANQRLDNQATKYRK |
Sequence similarities
Belongs to the Lpp family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length78
- Mass (Da)8,391
- Last updated2004-07-05 v1
- ChecksumA362AD45DD5B6A5F
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 57-78 | Basic and acidic residues | ||||
Sequence: AAKDDAARANQRLDNQATKYRK |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY333760 EMBL· GenBank· DDBJ | AAR02620.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE006468 EMBL· GenBank· DDBJ | AAL20301.1 EMBL· GenBank· DDBJ | Genomic DNA |