Q75K18 · SRP54_DICDI
- ProteinSignal recognition particle subunit SRP54
- Genesrp54
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids542 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Component of the signal recognition particle (SRP) complex, a ribonucleoprotein complex that mediates the cotranslational targeting of secretory and membrane proteins to the endoplasmic reticulum (ER). As part of the SRP complex, associates with the SRP receptor (SR) component srpra to target secretory proteins to the endoplasmic reticulum membrane. Binds to the signal sequence of presecretory proteins when they emerge from the ribosomes. Displays basal GTPase activity, and stimulates reciprocal GTPase activation of the SR subunit SRPRA. Forms a guanosine 5'-triphosphate (GTP)-dependent complex with the SR subunit srpra. SR compaction and GTPase mediated rearrangement of SR drive SRP-mediated cotranslational protein translocation into the ER (By similarity).
Requires the presence of srp9/srp14 and/or srp19 to stably interact with RNA (By similarity).
Requires the presence of srp9/srp14 and/or srp19 to stably interact with RNA (By similarity).
Catalytic activity
- GTP + H2O = GDP + H+ + phosphateThis reaction proceeds in the forward direction.
Features
Showing features for binding site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | endoplasmic reticulum | |
Cellular Component | phagocytic vesicle | |
Cellular Component | signal recognition particle, endoplasmic reticulum targeting | |
Molecular Function | 7S RNA binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | endoplasmic reticulum signal peptide binding | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Biological Process | SRP-dependent cotranslational protein targeting to membrane, translocation |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSignal recognition particle subunit SRP54
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Amoebozoa > Evosea > Eumycetozoa > Dictyostelia > Dictyosteliales > Dictyosteliaceae > Dictyostelium
Accessions
- Primary accessionQ75K18
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000327678 | 1-542 | Signal recognition particle subunit SRP54 | |||
Sequence: MVLADLGNQLSSALRSLNETTIVNEDTINQLLKEVGNALSKSDVSMSLIIQMRKNIKDKIKLDQMAAGLNKRKIIKQVVFDELIRLLDPGVPLWKPTKGKSNIVMFVGLQGAGKTTSVTKLAYFYKKKGFSTAIVCADTFRAGAFDQVRHNAAKAKIHYYGSETEKDPVVVARTGVDIFKKDGTEIIIVDTSGRHKQDSELFEEMKQIETAVKPDNCIFVMDSSIGQAAYEQATAFRSSVKVGSIIITKMDGNSMGGGAISAVAATNTPIIFIGTGEHLTDLELFDPSTFVSKLLGYGDMKGMLEKIKEVIPEDSTSLKEIAQGKFTLRSMQQQFQQIMQLGPIDKLVQMIPGMNQLPQLQGNEGGLKLKAYINILDSLSEKELDGKKPITQKRIITIAQGSGRHPNEVVELLEQHKTFEKLIGKGGPGGGLGSLMAGKGGPKNMEQAMKQMNANGGMQGLMNSLKGMGGMGDLAKMFGGGGGGGGGMPSMGDLAKMMGGMGGGGRGGGGMPNMGDLAKMMGGMGGGAGKGGQNGFPNLDLD |
Proteomic databases
Interaction
Subunit
Component of a signal recognition particle (SRP) complex that consists of a 7SL RNA molecule of 300 nucleotides and six protein subunits: srp72, srp68, srp54, srp19, srp14 and srp9.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-295 | G-domain | ||||
Sequence: MVLADLGNQLSSALRSLNETTIVNEDTINQLLKEVGNALSKSDVSMSLIIQMRKNIKDKIKLDQMAAGLNKRKIIKQVVFDELIRLLDPGVPLWKPTKGKSNIVMFVGLQGAGKTTSVTKLAYFYKKKGFSTAIVCADTFRAGAFDQVRHNAAKAKIHYYGSETEKDPVVVARTGVDIFKKDGTEIIIVDTSGRHKQDSELFEEMKQIETAVKPDNCIFVMDSSIGQAAYEQATAFRSSVKVGSIIITKMDGNSMGGGAISAVAATNTPIIFIGTGEHLTDLELFDPSTFVSKLL | ||||||
Region | 296-542 | M-domain | ||||
Sequence: GYGDMKGMLEKIKEVIPEDSTSLKEIAQGKFTLRSMQQQFQQIMQLGPIDKLVQMIPGMNQLPQLQGNEGGLKLKAYINILDSLSEKELDGKKPITQKRIITIAQGSGRHPNEVVELLEQHKTFEKLIGKGGPGGGLGSLMAGKGGPKNMEQAMKQMNANGGMQGLMNSLKGMGGMGDLAKMFGGGGGGGGGMPSMGDLAKMMGGMGGGGRGGGGMPNMGDLAKMMGGMGGGAGKGGQNGFPNLDLD |
Domain
The NG domain, also named G domain, is a special guanosine triphosphatase (GTPase) domain, which binds GTP and forms a guanosine 5'-triphosphate (GTP)-dependent complex with a homologous NG domain in the SRP receptor subunit srpra. The two NG domains undergo cooperative rearrangements upon their assembly, which culminate in the reciprocal activation of the GTPase activity of one another. SRP receptor compaction upon binding with cargo-loaded SRP and GTPase rearrangement drive SRP-mediated cotranslational protein translocation into the ER.
The M domain binds the 7SL RNA in presence of srp19 and binds the signal sequence of presecretory proteins.
Sequence similarities
Belongs to the GTP-binding SRP family. SRP54 subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length542
- Mass (Da)57,610
- Last updated2004-07-05 v1
- ChecksumF5AE74963AD00D20
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AAFI02000013 EMBL· GenBank· DDBJ | EAL69478.1 EMBL· GenBank· DDBJ | Genomic DNA |