Q75G87 · ACBP3_ORYSJ
- ProteinAcyl-CoA-binding domain-containing protein 3
- GeneACBP3
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids155 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Binds medium- and long-chain acyl-CoA esters with high affinity. Can interact in vitro with linolenoyl-CoA (PubMed:21128943).
Binds phosphatidic acid (PA) and phosphatidylcholine (PC) in vitro. May play a role in the biosynthesis of phospholipids (PubMed:24738983).
Binds phosphatidic acid (PA) and phosphatidylcholine (PC) in vitro. May play a role in the biosynthesis of phospholipids (PubMed:24738983).
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | fatty-acyl-CoA binding | |
Biological Process | fatty acid metabolic process |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended nameAcyl-CoA-binding domain-containing protein 3
- Short namesAcyl-CoA binding protein 3 ; OsACBP3
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ75G87
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000442033 | 1-155 | Acyl-CoA-binding domain-containing protein 3 | |||
Sequence: MGLQEDFEEYAEKVKTLPESTSNEDKLILYGLYKQATVGDVNTSRPGIFAQRDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAAALKAVFRAYLVGEMNIFECHIGRLTRCRRGFRTQMKKQIVYSPGTREMNLLSLIKPSLAHVGYCSTYG |
Proteomic databases
Expression
Tissue specificity
Highly expressed in leaves. Expressed at low levels in roots and seeds.
Induction
Down-regulated by cold stress, wounding and infection with the rice blast fungus Magnaporthe oryzae.
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 3-88 | ACB | ||||
Sequence: LQEDFEEYAEKVKTLPESTSNEDKLILYGLYKQATVGDVNTSRPGIFAQRDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAAA |
Sequence similarities
Belongs to the ACBP family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length155
- Mass (Da)17,668
- Last updated2004-07-05 v1
- Checksum97BCAAE1858A1DC7
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC146468 EMBL· GenBank· DDBJ | AAR10857.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DP000009 EMBL· GenBank· DDBJ | ABF97253.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008209 EMBL· GenBank· DDBJ | BAF12450.2 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AP014959 EMBL· GenBank· DDBJ | BAS85026.1 EMBL· GenBank· DDBJ | Genomic DNA |