Q75BS3 · Q75BS3_EREGS
- ProteinPurine nucleoside phosphorylase
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids308 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
The purine nucleoside phosphorylases catalyze the phosphorolytic breakdown of the N-glycosidic bond in the beta-(deoxy)ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate.
Pathway
Purine metabolism; purine nucleoside salvage.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 44 | phosphate (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 78 | phosphate (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 98-100 | phosphate (UniProtKB | ChEBI) | ||||
Sequence: RLH | ||||||
Binding site | 131 | phosphate (UniProtKB | ChEBI) | ||||
Sequence: A | ||||||
Binding site | 216 | a purine D-ribonucleoside (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 235 | phosphate (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 258 | a purine D-ribonucleoside (UniProtKB | ChEBI) | ||||
Sequence: N |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | inosine nucleosidase activity | |
Molecular Function | nicotinamide riboside hydrolase activity | |
Molecular Function | purine-nucleoside phosphorylase activity | |
Biological Process | guanosine catabolic process | |
Biological Process | inosine catabolic process | |
Biological Process | NAD biosynthesis via nicotinamide riboside salvage pathway | |
Biological Process | nicotinate nucleotide salvage |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePurine nucleoside phosphorylase
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Eremothecium
Accessions
- Primary accessionQ75BS3
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 38-305 | Nucleoside phosphorylase | ||||
Sequence: VLIICGSGLGGISHVISSNPQPLSVPYSAIPGFKASTIVGHAGDLLFGFMNKTPVVLMKGRLHGYEGNTAQEITRPIRILNELGSIGVLVVTNAAGAVNPEFSACELMCINDHISFPGLCGFHPLRGPNFDETGPRFLATSDAYDLKLRQLLFSKHKELGIARRLHEGVYAHVSGPTFESRAESRLIRLVGADCVGMSTVPEVVVARHCGWRVLALSLITNCVVLSPAASALDTNPVPLDLGKAEHSEVIVNAAAASADVEQLVEAVV |
Sequence similarities
Belongs to the PNP/MTAP phosphorylase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length308
- Mass (Da)32,717
- Last updated2004-07-05 v1
- Checksum2B26D6BD7E0BE51A
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE016816 EMBL· GenBank· DDBJ | AAS51424.1 EMBL· GenBank· DDBJ | Genomic DNA |