Q759H8 · Q759H8_EREGS

Function

function

Essential component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins.

Pathway

Protein modification; protein ubiquitination.

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular ComponentCBF3 complex
Cellular Componentcytoplasm
Cellular Componentkinetochore
Cellular Componentnuclear SCF ubiquitin ligase complex
Cellular Componentnucleus
Cellular ComponentRAVE complex
Cellular Componentsingle-stranded DNA-dependent ATP-dependent DNA helicase complex
Molecular Functioncullin family protein binding
Molecular FunctionDNA replication origin binding
Molecular Functionubiquitin protein ligase activity
Biological Processexit from mitosis
Biological ProcessG1/S transition of mitotic cell cycle
Biological ProcessG2/M transition of mitotic cell cycle
Biological Processkinetochore assembly
Biological Processmitotic cell cycle
Biological Processmitotic nuclear membrane biogenesis
Biological Processnegative regulation of cytoplasmic translation
Biological Processnegative regulation of mitotic metaphase/anaphase transition
Biological Processpositive regulation of glucose transmembrane transport
Biological Processprotein neddylation
Biological Processprotein ubiquitination
Biological Processregulation of DNA recombination
Biological Processregulation of exit from mitosis
Biological Processregulation of protein-containing complex assembly
Biological Processresolution of meiotic recombination intermediates
Biological ProcessSCF-dependent proteasomal ubiquitin-dependent protein catabolic process
Biological Processseptin ring assembly
Biological Processsilent mating-type cassette heterochromatin formation
Biological Processvacuolar acidification
Biological Processvacuolar proton-transporting V-type ATPase complex assembly

Keywords

Enzyme and pathway databases

Names & Taxonomy

Protein names

  • Recommended name
    E3 ubiquitin ligase complex SCF subunit

Gene names

    • ORF names
      AGOS_ADR295C

Organism names

Accessions

  • Primary accession
    Q759H8

Proteomes

Interaction

Subunit

Component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complexes.

Protein-protein interaction databases

Family & Domains

Features

Showing features for domain.

TypeIDPosition(s)Description
Domain7-40SKP1 component POZ
Domain54-84SKP1 component POZ
Domain129-176SKP1 component dimerisation

Sequence similarities

Belongs to the SKP1 family.

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    179
  • Mass (Da)
    20,896
  • Last updated
    2004-07-05 v1
  • Checksum
    8994F9B05204C2E6
MSEQNQTVVLVSVEGERFTVERKIAERSLLLKNYLNDMHDNAFRDESDDEADAADDDDRIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEEDDDSRKSAPVDAWDREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRNRSPEEIRRTFNIVNDFTPEEEAAIRRENEWAEDR

Keywords

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
AE016817
EMBL· GenBank· DDBJ
AAS52216.1
EMBL· GenBank· DDBJ
Genomic DNA

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp