Q74HC2 · DGK2_LACJO
- ProteinDeoxyguanosine kinase
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids224 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
DGK/DAK plays an essential role in generating the deoxyribonucleotide precursors, dGTP and dATP, for DNA metabolism.
Catalytic activity
- 2'-deoxyguanosine + ATP = ADP + dGMP + H+
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 8-16 | ATP (UniProtKB | ChEBI) | ||||
Sequence: GPIGAGKSS | ||||||
Binding site | 32 | substrate | ||||
Sequence: E | ||||||
Binding site | 44 | substrate | ||||
Sequence: Y | ||||||
Binding site | 55 | substrate | ||||
Sequence: Q | ||||||
Active site | 78 | Proton acceptor | ||||
Sequence: D | ||||||
Binding site | 79 | substrate | ||||
Sequence: R | ||||||
Binding site | 84 | substrate | ||||
Sequence: D | ||||||
Binding site | 149 | substrate | ||||
Sequence: E |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | ATP binding | |
Molecular Function | deoxyguanosine kinase activity |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDeoxyguanosine kinase
- EC number
- Short namesDGK; DGUO kinase
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageBacteria > Bacillota > Bacilli > Lactobacillales > Lactobacillaceae > Lactobacillus
Accessions
- Primary accessionQ74HC2
- Secondary accessions
Proteomes
PTM/Processing
Features
Showing features for initiator methionine, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Chain | PRO_0000239237 | 2-224 | Deoxyguanosine kinase | |||
Sequence: TVIVLSGPIGAGKSSLTGILSKYLGTNPFYESVDDNPVLPLFYENPKKYAFLLQVYFLNTRFRSIKSALTDDNNVLDRSIYEDALFFQMNADIGRATPEEVDTYYELLHNMMSELDRMPKKNPDLLVHIDVSYDTMLKRIQKRGRNYEQLSYDPTLEDYYKRLLRYYKPWYEKYDYSPKMTIDGDKLDFMASEEDRQEVLNQIVAKLKEMGKFEDDWKPNLVK |
Interaction
Subunit
Heterodimer of a deoxyadenosine (DAK) and a deoxyguanosine kinase (DGK).
Structure
Sequence
- Sequence statusComplete
- Length224
- Mass (Da)26,406
- Last updated2007-01-23 v3
- Checksum8DD02003CF396CDD
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 173 | in Ref. 1; AAB09751 | ||||
Sequence: E → A | ||||||
Sequence conflict | 214 | in Ref. 1; AAB09751 | ||||
Sequence: F → L |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U01881 EMBL· GenBank· DDBJ | AAB09751.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE017198 EMBL· GenBank· DDBJ | AAS09770.1 EMBL· GenBank· DDBJ | Genomic DNA |