Q72JC0 · PILA4_THET2
- ProteinType IV wide pilus major component PilA4
- GenepilA4
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids131 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays an essential role in the assembly of two types of T4P pili: a wide and a narrow that participate in natural transformation and twitching motility (PubMed:32376942).
Major component of the wide pilus that is essential for natural transformation working as a DNA translocator structure that spans the inner and outer membranes (PubMed:12839734, PubMed:16857013, PubMed:19396940, PubMed:32376942).
In addition, participates in the assembly of the narrow pilus composed of the PilA5 subunit that is required for twitching motility (PubMed:32376942).
Major component of the wide pilus that is essential for natural transformation working as a DNA translocator structure that spans the inner and outer membranes (PubMed:12839734, PubMed:16857013, PubMed:19396940, PubMed:32376942).
In addition, participates in the assembly of the narrow pilus composed of the PilA5 subunit that is required for twitching motility (PubMed:32376942).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell outer membrane | |
Cellular Component | periplasmic space | |
Cellular Component | plasma membrane | |
Cellular Component | type II protein secretion system complex | |
Biological Process | protein secretion by the type II secretion system |
Names & Taxonomy
Protein names
- Recommended nameType IV wide pilus major component PilA4
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Deinococcota > Deinococci > Thermales > Thermaceae > Thermus
Accessions
- Primary accessionQ72JC0
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Cell inner membrane ; Single-pass membrane protein
Cell outer membrane ; Single-pass membrane protein
Note: The single N-terminal transmembrane is initially involved in the correct localization to the inner membrane. Once the leader sequence cleaved, this region plays a role in multimerization and protein-protein interactions in the periplasm and the outer membrane.
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 7-27 | Helical | ||||
Sequence: FTLIELLIVIAIIAILAAVLI |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Deletion mutants show defect in both DNA transformation and twitching motility.
PTM/Processing
Features
Showing features for propeptide, modified residue, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Propeptide | PRO_0000450706 | 1-6 | Leader sequence | |||
Sequence: MRNAKG | ||||||
Modified residue | 7 | N-methylphenylalanine | ||||
Sequence: F | ||||||
Chain | PRO_0000450707 | 7-131 | Type IV wide pilus major component PilA4 | |||
Sequence: FTLIELLIVIAIIAILAAVLIPNLLAARKRANDTVVTAYLNDAVKFQEMYQIDNNSYTSNQAALISLGLKSTPANVTFSIVSASANSYCMIAGHSGGTVWFAATPDKGVYKTNTAVTSSQPESCP | ||||||
Disulfide bond | 95↔130 | |||||
Sequence: CMIAGHSGGTVWFAATPDKGVYKTNTAVTSSQPESC |
Post-translational modification
Found in three forms of 14-kDa, 18-kDa and a glycosylated 23-kDa form (PubMed:16857013).
Both narrow and wide pili are glycosylated (PubMed:32376942).
Both narrow and wide pili are glycosylated (PubMed:32376942).
Keywords
- PTM
Expression
Induction
By growth in minimal medium or low temperature leading to a significant increase in pilA4 transcripts.
Interaction
Subunit
Interacts with PilQ.
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length131
- Mass (Da)13,901
- Last updated2004-07-05 v1
- ChecksumA7F64A5E07A3FFA4
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE017221 EMBL· GenBank· DDBJ | AAS81202.1 EMBL· GenBank· DDBJ | Genomic DNA |