Q6ZU15 · SEP14_HUMAN
- ProteinSeptin-14
- GeneSEPTIN14
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids432 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Filament-forming cytoskeletal GTPase (Probable). Involved in the migration of cortical neurons and the formation of neuron leading processes during embryonic development (By similarity).
Plays a role in sperm head formation during spermiogenesis, potentially via facilitating localization of ACTN4 to cell filaments (PubMed:33228246).
Plays a role in sperm head formation during spermiogenesis, potentially via facilitating localization of ACTN4 to cell filaments (PubMed:33228246).
Features
Showing features for binding site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | acrosomal vesicle | |
Cellular Component | axon | |
Cellular Component | cell division site | |
Cellular Component | cytoplasm | |
Cellular Component | cytoskeleton | |
Cellular Component | dendrite | |
Cellular Component | microtubule cytoskeleton | |
Cellular Component | perikaryon | |
Cellular Component | perinuclear region of cytoplasm | |
Cellular Component | septin complex | |
Cellular Component | septin ring | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Molecular Function | molecular adaptor activity | |
Biological Process | cytoskeleton-dependent cytokinesis | |
Biological Process | neuron migration | |
Biological Process | protein localization | |
Biological Process | protein localization to perinuclear region of cytoplasm | |
Biological Process | spermatid development |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSeptin-14
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ6ZU15
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Colocalizes with actin stress fibers (PubMed:17922164).
Expressed in the perinuclear rim and manchette structure in early elongating spermatids during spermiogenesis (By similarity).
Expressed in the perinuclear rim and manchette structure in early elongating spermatids during spermiogenesis (By similarity).
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_085117 | 123 | found in patients with teratozoospermia; uncertain significance; sperm heads are malformed and contain vacuoles; chromatin packaging and structure is abnormal with an increase in fragmented DNA; decreases sperm filamentous structure formation; loss of SEPTIN14 and ACTN4 localization to cell filament structures; no effect on interaction with ACTN4; dbSNP:rs1417582759 | |||
Sequence: A → T | ||||||
Natural variant | VAR_085118 | 333 | found in patients with teratozoospermia; uncertain significance; sperm heads are malformed and contain vacuoles; chromatin packaging and structure is abnormal with an increase in fragmented DNA; decreases sperm filamentous structure formation; loss of SEPTIN14 and ACTN4 localization to cell filament structures; no effect on interaction with ACTN4; dbSNP:rs185254020 | |||
Sequence: I → T |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 537 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000294425 | 1-432 | Septin-14 | |||
Sequence: MAERTMAMPTQIPADGDTQKENNIRCLTTIGHFGFECLPNQLVSRSIRQGFTFNILCVGETGIGKSTLIDTLFNTNLKDNKSSHFYSNVGLQIQTYELQESNVQLKLTVVETVGYGDQIDKEASYQPIVDYIDAQFEAYLQEELKIKRSLFEYHDSRVHVCLYFISPTGHSLKSLDLLTMKNLDSKVNIIPLIAKADTISKNDLQTFKNKIMSELISNGIQIYQLPTDEETAAQANSSVSGLLPFAVVGSTDEVKVGKRMVRGRHYPWGVLQVENENHCDFVKLRDMLLCTNMENLKEKTHTQHYECYRYQKLQKMGFTDVGPNNQPVSFQEIFEAKRQEFYDQCQREEEELKQRFMQRVKEKEATFKEAEKELQDKFEHLKMIQQEEIRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTKKDKHRKK |
Proteomic databases
PTM databases
Interaction
Subunit
Septins polymerize into heterooligomeric protein complexes that form filaments, and can associate with cellular membranes, actin filaments and microtubules. GTPase activity is required for filament formation. Interacts with ACTN4 (PubMed:33228246).
Interacts with SEPTIN9 (PubMed:17922164).
Interacts (via C-terminus) with SEPTIN4 (By similarity).
Interacts with SEPTIN9 (PubMed:17922164).
Interacts (via C-terminus) with SEPTIN4 (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q6ZU15 | ARMC7 Q9H6L4 | 3 | EBI-2009297, EBI-742909 | |
BINARY | Q6ZU15 | FAM124B Q9H5Z6-2 | 3 | EBI-2009297, EBI-11986315 | |
BINARY | Q6ZU15 | GORASP2 Q9H8Y8 | 3 | EBI-2009297, EBI-739467 | |
BINARY | Q6ZU15 | NTAQ1 Q96HA8 | 3 | EBI-2009297, EBI-741158 | |
BINARY | Q6ZU15 | SEPTIN9 Q9UHD8-1 | 3 | EBI-2009297, EBI-851558 | |
BINARY | Q6ZU15 | SEPTIN9 Q9UHD8-3 | 3 | EBI-2009297, EBI-851569 | |
BINARY | Q6ZU15 | VPS25 Q9BRG1 | 3 | EBI-2009297, EBI-741945 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 49-315 | Septin-type G | ||||
Sequence: QGFTFNILCVGETGIGKSTLIDTLFNTNLKDNKSSHFYSNVGLQIQTYELQESNVQLKLTVVETVGYGDQIDKEASYQPIVDYIDAQFEAYLQEELKIKRSLFEYHDSRVHVCLYFISPTGHSLKSLDLLTMKNLDSKVNIIPLIAKADTISKNDLQTFKNKIMSELISNGIQIYQLPTDEETAAQANSSVSGLLPFAVVGSTDEVKVGKRMVRGRHYPWGVLQVENENHCDFVKLRDMLLCTNMENLKEKTHTQHYECYRYQKLQK | ||||||
Region | 59-66 | G1 motif | ||||
Sequence: GETGIGKS | ||||||
Region | 111-114 | G3 motif | ||||
Sequence: ETVG | ||||||
Region | 194-197 | G4 motif | ||||
Sequence: AKAD | ||||||
Coiled coil | 332-412 | |||||
Sequence: EIFEAKRQEFYDQCQREEEELKQRFMQRVKEKEATFKEAEKELQDKFEHLKMIQQEEIRKLEEEKKQLEGEIIDFYKMKAA | ||||||
Region | 369-432 | Required for interaction with SEPTIN4. Required for migration of cortical neurons during corticogenesis | ||||
Sequence: EAEKELQDKFEHLKMIQQEEIRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTKKDKHRKK |
Sequence similarities
Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. Septin GTPase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length432
- Mass (Da)50,025
- Last updated2007-07-10 v2
- ChecksumAFFF9A953F1FC637
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK126048 EMBL· GenBank· DDBJ | BAC86412.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK301928 EMBL· GenBank· DDBJ | BAG63348.1 EMBL· GenBank· DDBJ | mRNA | ||
AC092647 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |