Q6ZBH9 · NCKP1_ORYSJ
- ProteinProbable protein NAP1
- GeneNAP1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1359 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex (By similarity).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | nucleus | |
Cellular Component | SCAR complex | |
Biological Process | actin filament organization | |
Biological Process | cell migration | |
Biological Process | cell morphogenesis | |
Biological Process | cell projection assembly | |
Biological Process | cortical actin cytoskeleton organization | |
Biological Process | multidimensional cell growth | |
Biological Process | positive regulation of DNA-templated transcription | |
Biological Process | trichome morphogenesis |
Names & Taxonomy
Protein names
- Recommended nameProbable protein NAP1
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ6ZBH9
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000216179 | 1-1359 | UniProt | Probable protein NAP1 | |||
Sequence: MAHVSFKSKEADSMSRWSKYLSTEESPPSASLSWRAMGVDGPQGSASGQKHLQMEPVVQLSKVAEGLLAKMYRLNSILDYPDPNAHTFSEAFWKAGVMPNFPKICITLSKKFPEHPNKLQLEKVDKFALDALNENAEGYMQNLEQWITLLLDLLEFREQALRLILDLSSTVITLLPHQNSLILHAFMDLFCSFVRVNLFSDKIPRKMILQVYNILHIMLKGGRDCEFYHRLVQFVDLYDPPVKGLHEDLNFVSPRIGEVLEAVGPIIFLSTDTKKLRNEGFLSPFHPRYPDILTNSAHPMRAQDLANVTSYREWVLLGYLVCPDELLRVTSIDVAMVVLKENLVLSLFRDEYILLHENYQLYVLPKVLESKRMAKSGRTKQKEADLEYNVAKQVEKMLMEVHEQALVSADALHHERRILLKQEIGRMVLFFTDQPSLLAPNIQMVFSALALAQCEVVWYFQHVGIASSKSSRGRTVDIDAADPTIGFLLDGMGKLCCLVRKYIAAIKGYALSYLSSCAGRIRFLLGTPGMVALDLDATLKGLFQQVLHCLENIPKPQGENVPAITCDLTDLRKHWLSILMIVTSSRSSVNIRHLEKATVSTGKEGLVSEGNAAYNWSRCVDELEGQLSKHGSLKKLYFYHQHLTTVFRNTMFGPEGRPQHCCAWLGAACCFPECASSIIPEEVNKIGRDSISYVESLIESIMGGLEGLINILDSEGGFGSLEMQLSPEQAAIRLNNATRAKAVSGLLAPGHESYPDNSSSVKMLEAAMQRLTSLCSVLNDMEPICVLNHVFILREYMRDCIIGNFRRRFHSMIRTDSCLQRPSVIESLLRRHLSIIHLAEQHISMDLTEGIREVLLAESFTGPFPNLQVFETPTETHGGGSAIDIISNWYIDNFVKDASRTGVVFDASQNCFRSSQPIGGGYLAEAFTDKRELKALVRLFGGYGVDRLDKLLREHTSALLNCIDSALRSNRDALEGLAGSVNSGDRIERDANLKQIIDIETLADFCIQAGQAITFRRLLVEAVGAVLEEKVPLIYSLLKGLAMQLPEEVPDKNEIIRLRRVASSVGVGDKHDAEWVHSILAEIGSANDNSWTLLPYLCAAFMASNMWSTTAYDVNTGGFSNNLHCLARCVSAVVGGSEYTRMEREHRRSSLSNGHMDELQEPELLSRVSAEANIKSAMQLYVKLSAGLVLDSWNDTSRPYIVPKLIFLDQLCEMSPYLPRSTLEVHIPYTILRSIYHQLYGASLMATEPMEPSPRQSPLISLAHASPSMKQNRADTTPRSHTFEPGYHSSSGSQYDEGYEGDRRTGERQLRSMRRSGPLDYTGTRKVKFVEGSSSGSHGAGSGSLQRFAVSRSGPLSYK | |||||||
Modified residue (large scale data) | 26 | PTMeXchange | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 45 | PTMeXchange | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1152 | PTMeXchange | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1253 | PTMeXchange | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1257 | PTMeXchange | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1289 | PTMeXchange | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1316 | PTMeXchange | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1353 | PTMeXchange | Phosphoserine | ||||
Sequence: S |
Proteomic databases
Expression
Gene expression databases
Interaction
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1267-1296 | Polar residues | ||||
Sequence: PSMKQNRADTTPRSHTFEPGYHSSSGSQYD | ||||||
Region | 1267-1359 | Disordered | ||||
Sequence: PSMKQNRADTTPRSHTFEPGYHSSSGSQYDEGYEGDRRTGERQLRSMRRSGPLDYTGTRKVKFVEGSSSGSHGAGSGSLQRFAVSRSGPLSYK | ||||||
Compositional bias | 1297-1314 | Basic and acidic residues | ||||
Sequence: EGYEGDRRTGERQLRSMR | ||||||
Compositional bias | 1328-1351 | Polar residues | ||||
Sequence: KFVEGSSSGSHGAGSGSLQRFAVS |
Sequence similarities
Belongs to the HEM-1/HEM-2 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,359
- Mass (Da)151,809
- Last updated2004-07-05 v1
- Checksum28A79B49481EB42A
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0P0XJ08 | A0A0P0XJ08_ORYSJ | Os08g0544500 | 465 | ||
Q0J3Z5 | Q0J3Z5_ORYSJ | Os08g0544500 | 1365 |
Sequence caution
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 1109 | in Ref. 3; AK059291 | ||||
Sequence: T → A | ||||||
Compositional bias | 1267-1296 | Polar residues | ||||
Sequence: PSMKQNRADTTPRSHTFEPGYHSSSGSQYD | ||||||
Compositional bias | 1297-1314 | Basic and acidic residues | ||||
Sequence: EGYEGDRRTGERQLRSMR | ||||||
Compositional bias | 1328-1351 | Polar residues | ||||
Sequence: KFVEGSSSGSHGAGSGSLQRFAVS |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP004632 EMBL· GenBank· DDBJ | BAD09729.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014964 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AK059291 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
AK071354 EMBL· GenBank· DDBJ | - | mRNA | No translation available. |