Q6YZF3 · SWT11_ORYSJ
- ProteinBidirectional sugar transporter SWEET11
- GeneSWEET11
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids307 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. Required for pollen viability. Involved in the transport of copper, in cooperation with COPT1 and COPT2 (PubMed:16648463, PubMed:20852017, PubMed:21107422, PubMed:25988582).
Confers sensitivity to bacterial blight mediated by X.oryzae pv. oryzae (Xoo) in its Xa13 allelic form (e.g. cv. IR24), probably by providing the sugar required for the pathogen growth, or by reducing copper contents in xylem. However, a recessive resistance can be associated with the xa13 allele (in which the promoter is mutated leading to reduced induction upon pathogen infection, e.g. cv. IRBB13), specifically toward Xoo Philippine race 6 and Indian race PXO8.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Cellular Component | plasma membrane | |
Molecular Function | sucrose transmembrane transporter activity | |
Molecular Function | sugar transmembrane transporter activity | |
Biological Process | carbohydrate transport | |
Biological Process | copper ion transport | |
Biological Process | defense response | |
Biological Process | sucrose transport |
Keywords
- Biological process
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameBidirectional sugar transporter SWEET11
- Short namesOsSWEET11
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ6YZF3
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-14 | Extracellular | ||||
Sequence: MAGGFLSMANPAVT | ||||||
Transmembrane | 15-35 | Helical; Name=1 | ||||
Sequence: LSGVAGNIISFLVFLAPVATF | ||||||
Topological domain | 36-47 | Cytoplasmic | ||||
Sequence: LQVYKKKSTGGY | ||||||
Transmembrane | 48-68 | Helical; Name=2 | ||||
Sequence: SSVPYVVALFSSVLWIFYALV | ||||||
Topological domain | 69-74 | Extracellular | ||||
Sequence: KTNSRP | ||||||
Transmembrane | 75-95 | Helical; Name=3 | ||||
Sequence: LLTINAFGCGVEAAYIVLYLV | ||||||
Topological domain | 96-107 | Cytoplasmic | ||||
Sequence: YAPRRARLRTLA | ||||||
Transmembrane | 108-128 | Helical; Name=4 | ||||
Sequence: FFLLLDVAAFALIVVTTLYLV | ||||||
Topological domain | 129-135 | Extracellular | ||||
Sequence: PKPHQVK | ||||||
Transmembrane | 136-156 | Helical; Name=5 | ||||
Sequence: FLGSVCLAFSMAVFVAPLSII | ||||||
Topological domain | 157-168 | Cytoplasmic | ||||
Sequence: FKVIKTKSVEFM | ||||||
Transmembrane | 169-189 | Helical; Name=6 | ||||
Sequence: PIGLSVCLTLSAVAWFCYGLF | ||||||
Topological domain | 190-194 | Extracellular | ||||
Sequence: TKDPY | ||||||
Transmembrane | 195-215 | Helical; Name=7 | ||||
Sequence: VMYPNVGGFFFSCVQMGLYFW | ||||||
Topological domain | 216-307 | Cytoplasmic | ||||
Sequence: YRKPRNTAVLPTTSDSMSPISAAAAATQRVIELPAGTHAFTILSVSPIPILGVHKVEVVAAEQAADGVAAAAAADKELLQNKPEVIEITAAV |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Reduced starch content in pollen and male sterility. Enhanced resistance against bacterial blight mediated by X.oryzae pv. oryzae (Xoo) strain PXO99(A).
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000404133 | 1-307 | UniProt | Bidirectional sugar transporter SWEET11 | |||
Sequence: MAGGFLSMANPAVTLSGVAGNIISFLVFLAPVATFLQVYKKKSTGGYSSVPYVVALFSSVLWIFYALVKTNSRPLLTINAFGCGVEAAYIVLYLVYAPRRARLRTLAFFLLLDVAAFALIVVTTLYLVPKPHQVKFLGSVCLAFSMAVFVAPLSIIFKVIKTKSVEFMPIGLSVCLTLSAVAWFCYGLFTKDPYVMYPNVGGFFFSCVQMGLYFWYRKPRNTAVLPTTSDSMSPISAAAAATQRVIELPAGTHAFTILSVSPIPILGVHKVEVVAAEQAADGVAAAAAADKELLQNKPEVIEITAAV | |||||||
Modified residue (large scale data) | 233 | PTMeXchange | Phosphoserine | ||||
Sequence: S |
Proteomic databases
Expression
Tissue specificity
Mostly expressed in panicles and anthers. Also detected in leaves (leaf collar, leaf auricle, leaf ligule), roots, sheaths, culms and culm nodes.
Induction
By the X.oryzae pv. oryzae (Xoo) transcription activator-like effector (TALe) protein pthXo1 and, possibly, AvrXa7.
Developmental stage
Accumulates to high levels in pollen grains, tapetal cells, and middle-layer cells of the anther wall. Also detected at high levels in connective tissue cells and the connective vascular element at the unicellular- to-bicellular pollen grain stages. At the tricellular pollen grain stage, confined to the cells of connective vascular elements.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 17-100 | MtN3/slv 1 | ||||
Sequence: GVAGNIISFLVFLAPVATFLQVYKKKSTGGYSSVPYVVALFSSVLWIFYALVKTNSRPLLTINAFGCGVEAAYIVLYLVYAPRR | ||||||
Domain | 136-219 | MtN3/slv 2 | ||||
Sequence: FLGSVCLAFSMAVFVAPLSIIFKVIKTKSVEFMPIGLSVCLTLSAVAWFCYGLFTKDPYVMYPNVGGFFFSCVQMGLYFWYRKP |
Sequence similarities
Belongs to the SWEET sugar transporter family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length307
- Mass (Da)32,978
- Last updated2004-07-05 v1
- Checksum6E505D8DA701B664
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
JN944367 EMBL· GenBank· DDBJ | AFI71278.1 EMBL· GenBank· DDBJ | mRNA | ||
AP005439 EMBL· GenBank· DDBJ | BAD13102.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP005528 EMBL· GenBank· DDBJ | BAD13168.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008214 EMBL· GenBank· DDBJ | BAF24268.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014964 EMBL· GenBank· DDBJ | BAT06435.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000145 EMBL· GenBank· DDBJ | EEE69066.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK106127 EMBL· GenBank· DDBJ | BAG97588.1 EMBL· GenBank· DDBJ | mRNA |