Q6YUS3 · TDR_ORYSJ
- ProteinTranscription factor TDR
- GeneTDR
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids552 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcription factor involved in the regulation of tapetum programmed cell death (PCD) and degradation during male reproductive development. Promotes tapetal PCD. Positively regulates the expression of two tapetum-specific genes, the cysteine protease CP1 and the lipid-transfer protein C6 (PubMed:17138695).
Acts upstream from and interacts with EAT1/DTD in the regulation of tapetal PCD (PubMed:23385589).
Regulates the expression of genes related to aliphatic metabolism during pollen development. May play regulatory role in the lipidic metabolism involved in the formation of pollen wall (PubMed:19825565).
Acts upstream from and interacts with EAT1/DTD in the regulation of tapetal PCD (PubMed:23385589).
Regulates the expression of genes related to aliphatic metabolism during pollen development. May play regulatory role in the lipidic metabolism involved in the formation of pollen wall (PubMed:19825565).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | protein dimerization activity | |
Molecular Function | sequence-specific DNA binding | |
Biological Process | anther development | |
Biological Process | anther morphogenesis | |
Biological Process | anther wall tapetum cell differentiation | |
Biological Process | regulation of DNA-templated transcription |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTranscription factor TDR
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ6YUS3
Proteomes
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000436457 | 1-552 | UniProt | Transcription factor TDR | |||
Sequence: MGRGDHLLMKNSNAAAAAAAVNGGGTSLDAALRPLVGSDGWDYCIYWRLSPDQRFLEMTGFCCSSELEAQVSALLDLPSSIPLDSSSIGMHAQALLSNQPIWQSSSEEEEADGGGGAKTRLLVPVAGGLVELFASRYMAEEQQMAELVMAQCGGGGAGDDGGGQAWPPPETPSFQWDGGADAQRLMYGGSSLNLFDAAAADDDPFLGGGGGDAVGDEAAAAGAWPYAGMAVSEPSVAVAQEQMQHAAGGGVAESGSEGRKLHGGDPEDDGDGEGRSGGAKRQQCKNLEAERKRRKKLNGHLYKLRSLVPNITKMDRASILGDAIDYIVGLQKQVKELQDELEDNHVHHKPPDVLIDHPPPASLVGLDNDDASPPNSHQQQPPLAVSGSSSRRSNKDPAMTDDKVGGGGGGGHRMEPQLEVRQVQGNELFVQVLWEHKPGGFVRLMDAMNALGLEVINVNVTTYKTLVLNVFRVMVRDSEVAVQADRVRDSLLEVTRETYPGVWPSPQEEDDAKFDGGDGGQAAAAAAAAGGEHYHDEVGGGYHQHLHYLAFD | |||||||
Modified residue (large scale data) | 306 | PTMeXchange | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 505 | PTMeXchange | Phosphoserine | ||||
Sequence: S |
Proteomic databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 241-289 | Disordered | ||||
Sequence: EQMQHAAGGGVAESGSEGRKLHGGDPEDDGDGEGRSGGAKRQQCKNLEA | ||||||
Compositional bias | 258-289 | Basic and acidic residues | ||||
Sequence: GRKLHGGDPEDDGDGEGRSGGAKRQQCKNLEA | ||||||
Region | 281-294 | Basic motif; degenerate | ||||
Sequence: RQQCKNLEAERKRR | ||||||
Domain | 281-330 | bHLH | ||||
Sequence: RQQCKNLEAERKRRKKLNGHLYKLRSLVPNITKMDRASILGDAIDYIVGL | ||||||
Region | 295-330 | Helix-loop-helix motif | ||||
Sequence: KKLNGHLYKLRSLVPNITKMDRASILGDAIDYIVGL | ||||||
Region | 347-414 | Disordered | ||||
Sequence: HHKPPDVLIDHPPPASLVGLDNDDASPPNSHQQQPPLAVSGSSSRRSNKDPAMTDDKVGGGGGGGHRM | ||||||
Compositional bias | 369-394 | Polar residues | ||||
Sequence: DDASPPNSHQQQPPLAVSGSSSRRSN |
Sequence similarities
Belongs to the bHLH protein family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length552
- Mass (Da)58,274
- Last updated2004-07-05 v1
- ChecksumB12EA5E1704C2D55
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 258-289 | Basic and acidic residues | ||||
Sequence: GRKLHGGDPEDDGDGEGRSGGAKRQQCKNLEA | ||||||
Compositional bias | 369-394 | Polar residues | ||||
Sequence: DDASPPNSHQQQPPLAVSGSSSRRSN |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP004078 EMBL· GenBank· DDBJ | BAD07594.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP005851 EMBL· GenBank· DDBJ | BAD08134.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008208 EMBL· GenBank· DDBJ | BAF07624.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014958 EMBL· GenBank· DDBJ | BAS76702.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000139 EMBL· GenBank· DDBJ | EEE56199.1 EMBL· GenBank· DDBJ | Genomic DNA |