Q6YTY0 · Q6YTY0_ORYSJ
- ProteinSmall nuclear ribonucleoprotein G
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | catalytic step 2 spliceosome | |
Cellular Component | P granule | |
Cellular Component | precatalytic spliceosome | |
Cellular Component | SMN-Sm protein complex | |
Cellular Component | spliceosomal tri-snRNP complex | |
Cellular Component | U1 snRNP | |
Cellular Component | U12-type spliceosomal complex | |
Cellular Component | U2 snRNP | |
Cellular Component | U2-type prespliceosome | |
Cellular Component | U4 snRNP | |
Cellular Component | U5 snRNP | |
Molecular Function | RNA binding | |
Biological Process | mRNA splicing, via spliceosome | |
Biological Process | spliceosomal snRNP assembly |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameSmall nuclear ribonucleoprotein G
- Short namessnRNP-G
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ6YTY0
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 5-76 | Sm | ||||
Sequence: GQPPDLKKYMDKKLQIKLNANRVVIGTLRGFDQFMNLVVDNTVEVNGNEKNDIGMVVIRGNSVVMIEALEPV |
Sequence similarities
Belongs to the snRNP Sm proteins family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length80
- Mass (Da)8,939
- Last updated2004-07-05 v1
- Checksum3B2087C5B9228804
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q0D4R5 | Q0D4R5_ORYSJ | Os07g0608700 | 67 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK243024 EMBL· GenBank· DDBJ | BAH01409.1 EMBL· GenBank· DDBJ | mRNA | ||
AP014963 EMBL· GenBank· DDBJ | BAT02589.1 EMBL· GenBank· DDBJ | Genomic DNA |