Q6Y223 · Q6Y223_PAGMA

Function

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentcytoplasm
Cellular Componentextracellular space
Cellular Componentplasma membrane
Molecular Functioncadherin binding involved in cell-cell adhesion
Molecular Functioncalcium ion binding
Molecular Functioncalcium-dependent phospholipid binding
Molecular Functionphospholipase A2 inhibitor activity
Biological Processalpha-beta T cell differentiation
Biological Processarachidonic acid secretion
Biological Processcell surface receptor signaling pathway
Biological Processcellular response to glucocorticoid stimulus
Biological Processcellular response to hydrogen peroxide
Biological Processcellular response to vascular endothelial growth factor stimulus
Biological ProcessDNA duplex unwinding
Biological Processendocrine pancreas development
Biological Processgliogenesis
Biological Processgranulocyte chemotaxis
Biological Processhepatocyte differentiation
Biological Processinflammatory response
Biological Processinsulin secretion
Biological Processkeratinocyte differentiation
Biological Processmyoblast migration involved in skeletal muscle regeneration
Biological Processnegative regulation of exocytosis
Biological Processnegative regulation of phospholipase A2 activity
Biological Processnegative regulation of T-helper 2 cell differentiation
Biological Processneutrophil clearance
Biological Processpositive regulation of cell migration involved in sprouting angiogenesis
Biological Processpositive regulation of G1/S transition of mitotic cell cycle
Biological Processpositive regulation of interleukin-2 production
Biological Processpositive regulation of neutrophil apoptotic process
Biological Processpositive regulation of prostaglandin biosynthetic process
Biological Processpositive regulation of T cell proliferation
Biological Processpositive regulation of T-helper 1 cell differentiation
Biological Processpositive regulation of vesicle fusion
Biological Processpositive regulation of wound healing
Biological Processprostate gland development
Biological Processregulation of cell shape
Biological Processregulation of hormone secretion
Biological Processregulation of inflammatory response
Biological Processregulation of interleukin-1 production
Biological Processregulation of leukocyte migration
Biological Processresponse to estradiol
Biological Processresponse to interleukin-1
Biological Processresponse to peptide hormone
Biological Processresponse to X-ray

Subcellular Location

Family & Domains

Sequence similarities

Belongs to the annexin family.

Keywords

Family and domain databases

Sequence

  • Sequence status
    Fragment
  • Length
    190
  • Mass (Da)
    21,537
  • Last updated
    2004-07-05 v1
  • Checksum
    C45F5139F1BFA740
ARGNQYKKDLEDDIKSDTSGDFRSALFELCKAGRTEGVCEQLIDSDARALYEAGEGRKGKDCSVFIEILTTRSALHLRKVFERYSKYSKVDVAKAIDLEMKGDIESLLTAVVKCAGSRPAYFAERLYLSMKGKSPRKNVLTRIMVARSEIDMKRIRDEYKKTYGKTLHQEILDDTKGDYEKILLALCGEN

Features

Showing features for non-terminal residue.

TypeIDPosition(s)Description
Non-terminal residue1

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
AY190715
EMBL· GenBank· DDBJ
AAP20190.1
EMBL· GenBank· DDBJ
mRNA

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
Help