Q6X6Z7 · TEKT3_MOUSE
- ProteinTektin-3
- GeneTekt3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids490 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia and flagellar axoneme (PubMed:37295417, PubMed:37865089, PubMed:37989994).
Forms filamentous polymers in the walls of ciliary and flagellar microtubules (PubMed:37295417).
Required for normal sperm mobility (PubMed:18951373).
Forms filamentous polymers in the walls of ciliary and flagellar microtubules (PubMed:37295417).
Required for normal sperm mobility (PubMed:18951373).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | acrosomal membrane | |
Cellular Component | acrosomal vesicle | |
Cellular Component | axonemal A tubule inner sheath | |
Cellular Component | axonemal microtubule | |
Cellular Component | cytoplasm | |
Cellular Component | microtubule cytoskeleton | |
Cellular Component | outer acrosomal membrane | |
Cellular Component | sperm flagellum | |
Biological Process | cilium assembly | |
Biological Process | cilium movement involved in cell motility | |
Biological Process | flagellated sperm motility | |
Biological Process | regulation of brood size |
Names & Taxonomy
Protein names
- Recommended nameTektin-3
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ6X6Z7
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cytoplasmic vesicle, secretory vesicle, acrosome outer membrane ; Peripheral membrane protein
Note: In spermatozoa, preferentially localizes to the flagella, but also found in the head (By similarity).
In the sperm flagellum, localizes to the periaxonemal region where it associates with the mitochondrial sheath and outer dense fibers (By similarity).
Not detected in the central axonemal region of the flagellum (By similarity).
Associates with the acrosome membrane in the equatorial segment of the sperm head (By similarity).
Also detected just below the plasma membrane in the post-acrosomal region where it might localize to the postacrosomal dense lamina (By similarity).
However, other studies report little or no expression in the postacrosomal region (By similarity).
Translocates from the postacrosomal region to the equatorial segment after sperm activation (By similarity).
Retained in the postacromal region, but not the equatorial segment, following the acrosome reaction (By similarity).
Some studies report strong expression in the anterior cap region (By similarity).
However, other studies report little or no expression in the acrosomal cap (By similarity).
In the sperm flagellum, localizes to the periaxonemal region where it associates with the mitochondrial sheath and outer dense fibers (By similarity).
Not detected in the central axonemal region of the flagellum (By similarity).
Associates with the acrosome membrane in the equatorial segment of the sperm head (By similarity).
Also detected just below the plasma membrane in the post-acrosomal region where it might localize to the postacrosomal dense lamina (By similarity).
However, other studies report little or no expression in the postacrosomal region (By similarity).
Translocates from the postacrosomal region to the equatorial segment after sperm activation (By similarity).
Retained in the postacromal region, but not the equatorial segment, following the acrosome reaction (By similarity).
Some studies report strong expression in the anterior cap region (By similarity).
However, other studies report little or no expression in the acrosomal cap (By similarity).
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Sperm with reduced motility (47%) and forward progression and increased flagellar structural bending defects. However, normal fertility is maintained.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 27 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000184569 | 1-490 | Tektin-3 | |||
Sequence: MELLGSTLTATYAHPPPASASFLPAIGTITSSYKDRFPHRNLTHSLSLPWRPNTYYKTAYNYPTLAPYSSRSQRVCESTMLPFVSNRTTFFTRYTPDDWYRSNLVSFQESNSSRHNSERLRVDTSRLIQDKYQQIRKTQAHSTQNLGERVNDLAFWKSEITHELDEMIGETNALTDIKRRLERGLIETEGPLQVSRECLFHREKRMGIDLVHDEAEKELLAEVDTILCCQERMRQHLDKANAQLASDRSAQHELEKDLSDKQAALRIDDKCQHLRNTSEGVSYFRGVERVDATVSVPETWAKFTDDNVLRSQSERAASAKLREETENLLIVTANEMWNQFNKVNLAFTNRIAETVDAKNKIHTHLTKTLQEIFQIEMTIESIKKAIKEKSAFLKVAQTRLDERTRRPNVELCRDMAQLRLVNEVYEVDETIQTLQQRLRDSEDTLQSLAHTKATLEHDLAVKANTLYIDQEKCMSMRNSYPSTLRLVGYC | ||||||
Glycosylation | 7 | O-linked (GalNAc...) threonine | ||||
Sequence: T | ||||||
Glycosylation | 9 | O-linked (GalNAc...) threonine | ||||
Sequence: T | ||||||
Glycosylation | 11 | O-linked (GalNAc...) threonine | ||||
Sequence: T | ||||||
Glycosylation | 41 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 86 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 111 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 276 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Post-translational modification
N- and O-glycosylated.
Ubiquitinated, leading to its degradation. Deubiquitinated by USP16, promoting its stability.
May be proteolytically processed during the epididymal transit of spermatozoa.
Keywords
- PTM
Proteomic databases
PTM databases
Structure
Family & Domains
Features
Showing features for coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 415-461 | |||||
Sequence: MAQLRLVNEVYEVDETIQTLQQRLRDSEDTLQSLAHTKATLEHDLAV |
Sequence similarities
Belongs to the tektin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length490
- Mass (Da)56,673
- Last updated2004-07-05 v1
- ChecksumC09CA9491D501C15
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY252101 EMBL· GenBank· DDBJ | AAP86970.1 EMBL· GenBank· DDBJ | mRNA |